Leptonychotes weddellii (Weddell seal): 102748842 Help Entry 102748842         CDS       T08708                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04060   Cytokine-cytokine receptor interaction lww04151   PI3K-Akt signaling pathway lww04217   Necroptosis lww04380   Osteoclast differentiation lww04620   Toll-like receptor signaling pathway lww04621   NOD-like receptor signaling pathway lww04622   RIG-I-like receptor signaling pathway lww04623   Cytosolic DNA-sensing pathway lww04630   JAK-STAT signaling pathway lww04650   Natural killer cell mediated cytotoxicity lww04668   TNF signaling pathway lww04936   Alcoholic liver disease lww05135   Yersinia infection lww05142   Chagas disease lww05152   Tuberculosis lww05160   Hepatitis C lww05161   Hepatitis B lww05162   Measles lww05163   Human cytomegalovirus infection lww05164   Influenza A lww05165   Human papillomavirus infection lww05167   Kaposi sarcoma-associated herpesvirus infection lww05168   Herpes simplex virus 1 infection lww05169   Epstein-Barr virus infection lww05170   Human immunodeficiency virus 1 infection lww05171   Coronavirus disease - COVID-19 lww05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:lww00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102748842 (IFNB1)    04668 TNF signaling pathway     102748842 (IFNB1)    04151 PI3K-Akt signaling pathway     102748842 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102748842 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102748842 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102748842 (IFNB1)    04621 NOD-like receptor signaling pathway     102748842 (IFNB1)    04622 RIG-I-like receptor signaling pathway     102748842 (IFNB1)    04623 Cytosolic DNA-sensing pathway     102748842 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     102748842 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     102748842 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102748842 (IFNB1)    05161 Hepatitis B     102748842 (IFNB1)    05160 Hepatitis C     102748842 (IFNB1)    05171 Coronavirus disease - COVID-19     102748842 (IFNB1)    05164 Influenza A     102748842 (IFNB1)    05162 Measles     102748842 (IFNB1)    05168 Herpes simplex virus 1 infection     102748842 (IFNB1)    05163 Human cytomegalovirus infection     102748842 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     102748842 (IFNB1)    05169 Epstein-Barr virus infection     102748842 (IFNB1)    05165 Human papillomavirus infection     102748842 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     102748842 (IFNB1)    05152 Tuberculosis     102748842 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     102748842 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102748842 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102748842 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lww04052]     102748842 (IFNB1) Cytokines and neuropeptides [BR:lww04052]  Cytokines   Interferons    102748842 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  102748842 NCBI-ProteinID:  XP_006733008 UniProt:  A0A2U3XNU1 LinkDB All DBs Position Unknown AA seq 182 aa AA seqDB search MTSRCILQTALLVSFSTTVLAVNYDLLQFQLSSSSVEYQELLLQLNGTSKDCLKDRMNFK IPEEIEKSQQFQKEDIILITLEMVRKTSDIFRRNLSSTGWNETIVEDLLATLHRQKEYLE EIMEEGNFTWDHRTLLHLKRYYLRIVQYLKAKEYSICAWIIVQAEILRSFFFLDKLTDYL LN NT seq 549 nt NT seq  +upstreamnt  +downstreamnt atgaccagcaggtgcatcctccaaactgcactcctggtgtctttctccaccacggttctt gccgtgaactacgacttgcttcaattccaactaagcagcagcagtgtggagtaccaggag ctccttctgcagttgaatggaacttctaaagattgcctcaaggacagaatgaacttcaag atccctgaggagattgagaaatcccaacagttccagaaggaggacatcatattgatcacc cttgagatggtccggaagacctctgatattttcaggagaaatctctcgagcacaggatgg aatgagaccattgttgaggacctccttgcgacactccacaggcagaaggaatatctggag gaaatcatggaggagggaaacttcacctgggaccacaggacccttctgcacctgaagaga tactatctaaggattgtgcagtacctgaaggccaaggagtacagcatctgtgcctggata atagtgcaagcagaaatcctcaggagctttttcttccttgataaacttacggattatctc ctaaactga

DBGET integrated database retrieval system