Mya arenaria (softshell): 128221556 Help Entry 128221556         CDS       T09995                                  Name (RefSeq) dihydrofolate reductase-like   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism maea  Mya arenaria (softshell) Pathway maea00670   One carbon pool by folate maea00790   Folate biosynthesis maea01100   Metabolic pathways maea01240   Biosynthesis of cofactors maea04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:maea00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     128221556    00670 One carbon pool by folate     128221556  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     128221556 Enzymes [BR:maea01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      128221556 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  128221556 NCBI-ProteinID:  XP_052786122 LinkDB All DBs Position 16:31419909..31425625 Genome browser AA seq 119 aa AA seqDB search MTGDHCIETDVQGIVPHESLLKVVGSFEESLVFIDELAETECVDSVWIMGGSHLYQESLA HPRCRKLYLTHVNTDFQSDTYFPEFENGFKEIPNDVSDITRHEENGVSFDFKLYERMSS NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgaccggtgatcattgtattgagactgacgttcaaggcatagtccctcatgagagtttg ttgaaggttgttgggagttttgaagagtcacttgtgtttattgatgagctggcggagacg gagtgcgtagacagtgtttggataatgggtgggagccatctgtaccaggagtctttggcc catccacgctgccggaaactttacttgacgcacgtaaatacggacttccaatccgataca tacttcccggagttcgaaaacggctttaaggaaataccaaacgatgtttcggacatcacg aggcatgaagaaaatggtgtttcctttgactttaagctttacgaaaggatgtcgtcataa

DBGET integrated database retrieval system