Molothrus aeneus (bronzed cowbird): 136557164 Help Entry 136557164         CDS       T11621                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism maen  Molothrus aeneus (bronzed cowbird) Pathway maen03420   Nucleotide excision repair maen04110   Cell cycle maen04114   Oocyte meiosis maen04120   Ubiquitin mediated proteolysis maen04141   Protein processing in endoplasmic reticulum maen04310   Wnt signaling pathway maen04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:maen00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     136557164 (RBX1)    04120 Ubiquitin mediated proteolysis     136557164 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     136557164 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     136557164 (RBX1)    04350 TGF-beta signaling pathway     136557164 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     136557164 (RBX1)    04114 Oocyte meiosis     136557164 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:maen04121]     136557164 (RBX1)    03400 DNA repair and recombination proteins [BR:maen03400]     136557164 (RBX1) Enzymes [BR:maen01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      136557164 (RBX1) Ubiquitin system [BR:maen04121]  Ubiquitin ligases (E3)   UBL E3 ligases    136557164 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      136557164 (RBX1)    Cul2 complex      136557164 (RBX1)    Cul3 complex      136557164 (RBX1)    Cul4 complex      136557164 (RBX1)    Cul7 complex      136557164 (RBX1)    Cul8 complex      136557164 (RBX1)    Cul9 complex      136557164 (RBX1) DNA repair and recombination proteins [BR:maen03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       136557164 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       136557164 (RBX1) SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  136557164 NCBI-ProteinID:  XP_066406860 LinkDB All DBs Position 5:20792558..20803474 Genome browser AA seq 121 aa AA seqDB search MRAEPDGPIHAPKMAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRN HIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYG H NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgcgcgcggagccggacgggccgattcacgcacccaaaatggcggccgcaatggatgtg gacacccccagcggaaccaacagcggcgccggcaagaagcgcttcgaagtgaagaaatgg aacgccgtggctctgtgggcatgggacattgtggttgataactgtgccatttgcagaaac cacattatggatctgtgcatagaatgtcaagccaaccaagcgtcggctacctctgaggag tgcacagttgcatggggtgtctgcaatcacgctttccatttccactgcatctctcgctgg ctcaaaactcgccaagtatgtccgctggacaacagggaatgggagttccaaaagtatgga cactag

DBGET integrated database retrieval system