Monopterus albus (swamp eel): 109952664 Help Entry 109952664         CDS       T05607                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism malb  Monopterus albus (swamp eel) Pathway malb03420   Nucleotide excision repair malb04110   Cell cycle malb04114   Oocyte meiosis malb04120   Ubiquitin mediated proteolysis malb04141   Protein processing in endoplasmic reticulum malb04310   Wnt signaling pathway malb04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:malb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109952664 (rbx1)    04120 Ubiquitin mediated proteolysis     109952664 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     109952664 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     109952664 (rbx1)    04350 TGF-beta signaling pathway     109952664 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     109952664 (rbx1)    04114 Oocyte meiosis     109952664 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:malb04121]     109952664 (rbx1)    03400 DNA repair and recombination proteins [BR:malb03400]     109952664 (rbx1) Enzymes [BR:malb01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      109952664 (rbx1) Ubiquitin system [BR:malb04121]  Ubiquitin ligases (E3)   UBL E3 ligases    109952664 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      109952664 (rbx1)    Cul2 complex      109952664 (rbx1)    Cul3 complex      109952664 (rbx1)    Cul4 complex      109952664 (rbx1)    Cul7 complex      109952664 (rbx1)    Cul8 complex      109952664 (rbx1)    Cul9 complex      109952664 (rbx1) DNA repair and recombination proteins [BR:malb03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       109952664 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       109952664 (rbx1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  109952664 NCBI-ProteinID:  XP_020443510 UniProt:  A0A3Q3JQ46 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPSGSNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcagcagctatggatgtggatacgccgagtggctcaaacagtggagcgagcaagaag cgatttgaagtaaagaagtggaacgctgtggcactgtgggcctgggacattgtggtggat aactgtgccatctgtcgaaaccacatcatggatctctgtatagagtgccaggccaaccaa gcttctgcaacctctgaggagtgcactgttgcctggggtgtctgcaatcatgccttccat ttccactgtatttctcgttggctgaaaaccagacaggtgtgccctctggacaacagggag tgggagtttcagaaatatggacactag

DBGET integrated database retrieval system