Mycteria americana (wood stork): 142409023 Help Entry 142409023         CDS       T11228                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism mame  Mycteria americana (wood stork) Pathway mame03420   Nucleotide excision repair mame04110   Cell cycle mame04114   Oocyte meiosis mame04120   Ubiquitin mediated proteolysis mame04141   Protein processing in endoplasmic reticulum mame04310   Wnt signaling pathway mame04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:mame00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     142409023 (RBX1)    04120 Ubiquitin mediated proteolysis     142409023 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     142409023 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     142409023 (RBX1)    04350 TGF-beta signaling pathway     142409023 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     142409023 (RBX1)    04114 Oocyte meiosis     142409023 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mame04121]     142409023 (RBX1)    03400 DNA repair and recombination proteins [BR:mame03400]     142409023 (RBX1) Enzymes [BR:mame01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      142409023 (RBX1) Ubiquitin system [BR:mame04121]  Ubiquitin ligases (E3)   UBL E3 ligases    142409023 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      142409023 (RBX1)    Cul2 complex      142409023 (RBX1)    Cul3 complex      142409023 (RBX1)    Cul4 complex      142409023 (RBX1)    Cul7 complex      142409023 (RBX1)    Cul8 complex      142409023 (RBX1)    Cul9 complex      142409023 (RBX1) DNA repair and recombination proteins [BR:mame03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       142409023 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       142409023 (RBX1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  142409023 NCBI-ProteinID:  XP_075356109 LinkDB All DBs Position 1:complement(56912416..56924323) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggccgcgatggatgtggacacccctagcggcaccaacagcggcgccggcaagaag cgcttcgaagtgaagaaatggaacgcagtagctctgtgggcatgggacattgtggttgat aactgtgccatttgcagaaaccatattatggatctatgcatagaatgtcaagcaaaccaa gcatcagctacctctgaagagtgcacagttgcatggggcgtctgcaatcatgctttccac ttccactgcatctctcgctggctcaaaactcgccaagtatgtccgctggacaacagagaa tgggagttccaaaagtatggacactag

DBGET integrated database retrieval system