Mycteria americana (wood stork): 142421349 Help Entry 142421349         CDS       T11228                                  Name (RefSeq) hepatic lectin-like   KO K06563   C-type lectin domain family 4 member L/M Organism mame  Mycteria americana (wood stork) Pathway mame03260   Virion - Human immunodeficiency virus mame03264   Virion - Flavivirus and Alphavirus mame03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus mame03273   Virion - Lassa virus and SFTS virus mame04145   Phagosome mame04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:mame00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     142421349    03264 Virion - Flavivirus and Alphavirus     142421349    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     142421349    03273 Virion - Lassa virus and SFTS virus     142421349  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     142421349  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     142421349  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mame04131]     142421349   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:mame04054]     142421349    04515 Cell adhesion molecules [BR:mame04515]     142421349    04090 CD molecules [BR:mame04090]     142421349    04091 Lectins [BR:mame04091]     142421349 Membrane trafficking [BR:mame04131]  Endocytosis   Phagocytosis    C-lectin receptors     142421349 Pattern recognition receptors [BR:mame04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    142421349 Cell adhesion molecules [BR:mame04515]  Lectins   Selectins and C-type lectins    142421349 CD molecules [BR:mame04090]  Proteins   142421349 Lectins [BR:mame04091]  C-Type lectins   Asialoglycoprotein and DC receptors    142421349 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  142421349 NCBI-ProteinID:  XP_075382125 LinkDB All DBs Position 28:complement(788061..791373) Genome browser AA seq 208 aa AA seqDB search MDEEHLHDDLHVFKDRNFFQQKLRSFFTVYLLLALSFLLIITLFAVSLSRVSAVSSKLNE VRPNWKHNFSDKDFLLFPCGPKSREWEYFDGKCYYFSLTRMSWYKAKAQCEEMRSQLAVI NSYAKQNFVMFRTRNERFWIGLTDQNSEGEWEWIDGTDYKSTFTFWKEGEPNNSENREDC AHVWFSGEWNDVYCTYECYYICEKPPPN NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggacgaggaacatcttcacgacgacctgcacgtttttaaagatagaaacttcttccag cagaagctgagatcttttttcaccgtatacttgctactggccctctccttcttgctgatc atcaccctgtttgctgtgtcgctctccagagtttcagccgtttcttctaaactcaacgag gtacgcccgaactggaaacacaacttttctgacaaggattttctgttgtttccctgcgga cccaaatccagggaatgggaatactttgatggaaaatgttactacttctccctaacccga atgagctggtacaaggcgaaggctcagtgcgaagagatgcgctcgcagttggctgtcatt aacagctacgccaagcagaattttgtcatgttcaggaccaggaatgagcgtttctggatc gggctcacggaccagaactcggaaggggaatgggaatggatcgacgggaccgactataaa agcacgttcacgttttggaaggagggagagcccaacaacagcgaaaacagggaagattgt gcccacgtctggttctctggggagtggaacgacgtctactgcacctacgagtgctactac atctgtgaaaagcctccgcccaactga

DBGET integrated database retrieval system