Mesocricetus auratus (golden hamster): 101828252 Help Entry 101828252         CDS       T08306                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism maua  Mesocricetus auratus (golden hamster) Pathway maua00510   N-Glycan biosynthesis maua00513   Various types of N-glycan biosynthesis maua04141   Protein processing in endoplasmic reticulum Module maua_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:maua00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     101828252    00513 Various types of N-glycan biosynthesis     101828252  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101828252 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  101828252 NCBI-ProteinID:  XP_040608748 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MELEAMSRCTGRVRSAVSPCLTVALLAIGMFFTAWFFVCKVTSTKYTLDIYIELLISLVA SLFMDFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctggaggccatgagtcggtgcaccggccgggtcaggtcggctgtctccccatgc ttgactgtggcacttctggccatcggcatgttcttcactgcctggttcttcgtttgcaag gtcacctctaccaagtacacactcgatatttacatagagctcctcatctccttggtggcc tcgctcttcatggactttggagtcctcttcctcctgctctgggttggcatctatgtatga

DBGET integrated database retrieval system