Mesocricetus auratus (golden hamster): 101831721 Help Entry 101831721         CDS       T08306                                  Symbol Fos Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism maua  Mesocricetus auratus (golden hamster) Pathway maua01522   Endocrine resistance maua04010   MAPK signaling pathway maua04024   cAMP signaling pathway maua04210   Apoptosis maua04380   Osteoclast differentiation maua04620   Toll-like receptor signaling pathway maua04657   IL-17 signaling pathway maua04658   Th1 and Th2 cell differentiation maua04659   Th17 cell differentiation maua04660   T cell receptor signaling pathway maua04662   B cell receptor signaling pathway maua04668   TNF signaling pathway maua04713   Circadian entrainment maua04725   Cholinergic synapse maua04728   Dopaminergic synapse maua04915   Estrogen signaling pathway maua04917   Prolactin signaling pathway maua04921   Oxytocin signaling pathway maua04926   Relaxin signaling pathway maua04928   Parathyroid hormone synthesis, secretion and action maua04932   Non-alcoholic fatty liver disease maua04935   Growth hormone synthesis, secretion and action maua05031   Amphetamine addiction maua05132   Salmonella infection maua05133   Pertussis maua05135   Yersinia infection maua05140   Leishmaniasis maua05142   Chagas disease maua05161   Hepatitis B maua05162   Measles maua05166   Human T-cell leukemia virus 1 infection maua05167   Kaposi sarcoma-associated herpesvirus infection maua05170   Human immunodeficiency virus 1 infection maua05171   Coronavirus disease - COVID-19 maua05200   Pathways in cancer maua05207   Chemical carcinogenesis - receptor activation maua05208   Chemical carcinogenesis - reactive oxygen species maua05210   Colorectal cancer maua05224   Breast cancer maua05231   Choline metabolism in cancer maua05235   PD-L1 expression and PD-1 checkpoint pathway in cancer maua05323   Rheumatoid arthritis maua05417   Lipid and atherosclerosis maua05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:maua00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101831721 (Fos)    04668 TNF signaling pathway     101831721 (Fos)    04024 cAMP signaling pathway     101831721 (Fos)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     101831721 (Fos)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101831721 (Fos)    04660 T cell receptor signaling pathway     101831721 (Fos)    04658 Th1 and Th2 cell differentiation     101831721 (Fos)    04659 Th17 cell differentiation     101831721 (Fos)    04657 IL-17 signaling pathway     101831721 (Fos)    04662 B cell receptor signaling pathway     101831721 (Fos)   09152 Endocrine system    04915 Estrogen signaling pathway     101831721 (Fos)    04917 Prolactin signaling pathway     101831721 (Fos)    04921 Oxytocin signaling pathway     101831721 (Fos)    04926 Relaxin signaling pathway     101831721 (Fos)    04935 Growth hormone synthesis, secretion and action     101831721 (Fos)    04928 Parathyroid hormone synthesis, secretion and action     101831721 (Fos)   09156 Nervous system    04725 Cholinergic synapse     101831721 (Fos)    04728 Dopaminergic synapse     101831721 (Fos)   09158 Development and regeneration    04380 Osteoclast differentiation     101831721 (Fos)   09159 Environmental adaptation    04713 Circadian entrainment     101831721 (Fos)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101831721 (Fos)    05207 Chemical carcinogenesis - receptor activation     101831721 (Fos)    05208 Chemical carcinogenesis - reactive oxygen species     101831721 (Fos)    05231 Choline metabolism in cancer     101831721 (Fos)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101831721 (Fos)   09162 Cancer: specific types    05210 Colorectal cancer     101831721 (Fos)    05224 Breast cancer     101831721 (Fos)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101831721 (Fos)    05170 Human immunodeficiency virus 1 infection     101831721 (Fos)    05161 Hepatitis B     101831721 (Fos)    05171 Coronavirus disease - COVID-19     101831721 (Fos)    05162 Measles     101831721 (Fos)    05167 Kaposi sarcoma-associated herpesvirus infection     101831721 (Fos)   09171 Infectious disease: bacterial    05132 Salmonella infection     101831721 (Fos)    05135 Yersinia infection     101831721 (Fos)    05133 Pertussis     101831721 (Fos)   09174 Infectious disease: parasitic    05140 Leishmaniasis     101831721 (Fos)    05142 Chagas disease     101831721 (Fos)   09163 Immune disease    05323 Rheumatoid arthritis     101831721 (Fos)   09165 Substance dependence    05031 Amphetamine addiction     101831721 (Fos)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101831721 (Fos)    05418 Fluid shear stress and atherosclerosis     101831721 (Fos)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     101831721 (Fos)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     101831721 (Fos)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:maua03000]     101831721 (Fos)    04131 Membrane trafficking [BR:maua04131]     101831721 (Fos) Transcription factors [BR:maua03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     101831721 (Fos) Membrane trafficking [BR:maua04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     101831721 (Fos) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  101831721 NCBI-ProteinID:  XP_005086426 UniProt:  A0A1U7QUN9 LinkDB All DBs Position Unknown AA seq 381 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLSVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSTGAYSRAGMVKTVSGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEATTPESEEAFS LPLLNDPEPKPSLEPVKSISNVELKAEPFDDFLFPASSRPSGSETTARSVPDMDLSGSFY AADWEPLHSSSLGMGPMVTELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHR KGSSSNEPSSDSLSSPTLLAL NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atgatgttttccggattcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc tctccggccggggacagcctttcctactaccactccccagccgactccttctccagcatg ggctcccctgtcaacgcacaggacttctgcacagatctgtccgtctccagtgccaacttt atccccaccgtgacagccatctccaccagcccagacctgcagtggctggtgcagcccacc ctcgtctcctccgtggccccatcgcagaccagagcgccccatccctacggagtccccacc ccttcgactggggcttactccagggcgggaatggtgaagaccgtgtcaggcggcagagcg cagagcatcggcagaagaggcaaagtagagcagttatctcctgaagaggaagagaaacgg agaatccgaagggaaaggaataagatggctgcagccaaatgccggaatcggaggagggaa ctgactgatactctccaagcggagacagaccaacttgaagacgagaagtctgcgttgcag actgagattgccaatctgctcaaagagaaggagaaactggagttcattttggcagcccac cgacctgcctgcaagatcccagatgacctgggcttcccggaagagatgtctgtggcttcc ctggatttgactgggggtctgcctgaggctactaccccagagtccgaggaagccttctca ctgcctcttctcaatgaccctgagcccaagccatctctggagccagtcaagagcatcagc aatgtggagctgaaggctgagccctttgatgacttcttgttcccagcatcatccaggccc agtggctctgagacgacggcccgatctgtgccagacatggacctatccggttccttctat gcagcagactgggagcccttgcacagcagctccctggggatggggcccatggtcacagag ctggagcccctgtgcaccccggtggtcacctgtactcccagctgcacgacttacacgtct tcctttgtgttcacctaccccgaggctgactccttccccagctgtgccgctgcccaccga aagggcagcagcagcaacgagccctcctctgactccctcagctcacccacactgctggcc ctgtga

DBGET integrated database retrieval system