Mesocricetus auratus (golden hamster): 101838783 Help Entry 101838783         CDS       T08306                                  Symbol Nppa Name (RefSeq) natriuretic peptides A   KO K12334   natriuretic peptide A Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04022   cGMP-PKG signaling pathway maua04024   cAMP signaling pathway maua04066   HIF-1 signaling pathway maua04081   Hormone signaling maua04270   Vascular smooth muscle contraction maua04714   Thermogenesis maua04921   Oxytocin signaling pathway maua04923   Regulation of lipolysis in adipocytes maua04924   Renin secretion maua04925   Aldosterone synthesis and secretion maua05143   African trypanosomiasis Brite KEGG Orthology (KO) [BR:maua00001]  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     101838783 (Nppa)    04024 cAMP signaling pathway     101838783 (Nppa)    04022 cGMP-PKG signaling pathway     101838783 (Nppa)   09133 Signaling molecules and interaction    04081 Hormone signaling     101838783 (Nppa)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     101838783 (Nppa)    04921 Oxytocin signaling pathway     101838783 (Nppa)    04924 Renin secretion     101838783 (Nppa)    04925 Aldosterone synthesis and secretion     101838783 (Nppa)   09153 Circulatory system    04270 Vascular smooth muscle contraction     101838783 (Nppa)   09159 Environmental adaptation    04714 Thermogenesis     101838783 (Nppa)  09160 Human Diseases   09174 Infectious disease: parasitic    05143 African trypanosomiasis     101838783 (Nppa)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:maua04052]     101838783 (Nppa) Cytokines and neuropeptides [BR:maua04052]  Neuropeptides   Unclassified    101838783 (Nppa) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  101838783 NCBI-ProteinID:  XP_005079399 UniProt:  A0A1U7QRK4 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MGSFSITVGFFLLLAFWLPGHIGANPVYSAVSNTDLMDFKNLLDHLEEKMPLEDEVVPPQ ALSEQNDEAPGAALSSLPEVAPWTGEVNPPQRDGGTLGRSPWDPSDRSALLKSKLRALLA APRSLRRSSCFGGRIDRIGAQSGLGCNSFRYRR NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgggctccttctccatcaccgtgggcttcttcctcctcctggccttttggcttccgggc catattggagcgaaccctgtgtacagtgcagtgtccaacacagatctgatggatttcaag aacctgctggaccatctggaggagaagatgccgttagaagatgaggtcgtgcccccacag gccctgagtgagcagaatgatgaagcgccaggggcagcgctcagctctctccctgaggtg gctccctggactggagaggtcaacccacctcagagagatggcggtaccctggggcgcagc ccctgggacccctccgatagatctgctctcttgaaaagcaaactgagggctctgctagct gcccctcggagcctacggaggtccagctgcttcgggggtaggatcgacaggattggagcc cagagcggactaggatgtaatagcttccggtaccgaagataa

DBGET integrated database retrieval system