Mesocricetus auratus (golden hamster): 101839443 Help Entry 101839443         CDS       T08306                                  Symbol Il6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism maua  Mesocricetus auratus (golden hamster) Pathway maua01521   EGFR tyrosine kinase inhibitor resistance maua01523   Antifolate resistance maua04060   Cytokine-cytokine receptor interaction maua04061   Viral protein interaction with cytokine and cytokine receptor maua04066   HIF-1 signaling pathway maua04068   FoxO signaling pathway maua04151   PI3K-Akt signaling pathway maua04218   Cellular senescence maua04620   Toll-like receptor signaling pathway maua04621   NOD-like receptor signaling pathway maua04623   Cytosolic DNA-sensing pathway maua04625   C-type lectin receptor signaling pathway maua04630   JAK-STAT signaling pathway maua04640   Hematopoietic cell lineage maua04657   IL-17 signaling pathway maua04659   Th17 cell differentiation maua04668   TNF signaling pathway maua04672   Intestinal immune network for IgA production maua04931   Insulin resistance maua04932   Non-alcoholic fatty liver disease maua04933   AGE-RAGE signaling pathway in diabetic complications maua04936   Alcoholic liver disease maua05010   Alzheimer disease maua05020   Prion disease maua05022   Pathways of neurodegeneration - multiple diseases maua05132   Salmonella infection maua05133   Pertussis maua05134   Legionellosis maua05135   Yersinia infection maua05142   Chagas disease maua05143   African trypanosomiasis maua05144   Malaria maua05146   Amoebiasis maua05152   Tuberculosis maua05161   Hepatitis B maua05162   Measles maua05163   Human cytomegalovirus infection maua05164   Influenza A maua05166   Human T-cell leukemia virus 1 infection maua05167   Kaposi sarcoma-associated herpesvirus infection maua05168   Herpes simplex virus 1 infection maua05169   Epstein-Barr virus infection maua05171   Coronavirus disease - COVID-19 maua05200   Pathways in cancer maua05202   Transcriptional misregulation in cancer maua05321   Inflammatory bowel disease maua05323   Rheumatoid arthritis maua05332   Graft-versus-host disease maua05410   Hypertrophic cardiomyopathy maua05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:maua00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101839443 (Il6)    04668 TNF signaling pathway     101839443 (Il6)    04066 HIF-1 signaling pathway     101839443 (Il6)    04068 FoxO signaling pathway     101839443 (Il6)    04151 PI3K-Akt signaling pathway     101839443 (Il6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101839443 (Il6)    04061 Viral protein interaction with cytokine and cytokine receptor     101839443 (Il6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     101839443 (Il6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     101839443 (Il6)    04620 Toll-like receptor signaling pathway     101839443 (Il6)    04621 NOD-like receptor signaling pathway     101839443 (Il6)    04623 Cytosolic DNA-sensing pathway     101839443 (Il6)    04625 C-type lectin receptor signaling pathway     101839443 (Il6)    04659 Th17 cell differentiation     101839443 (Il6)    04657 IL-17 signaling pathway     101839443 (Il6)    04672 Intestinal immune network for IgA production     101839443 (Il6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101839443 (Il6)    05202 Transcriptional misregulation in cancer     101839443 (Il6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101839443 (Il6)    05161 Hepatitis B     101839443 (Il6)    05171 Coronavirus disease - COVID-19     101839443 (Il6)    05164 Influenza A     101839443 (Il6)    05162 Measles     101839443 (Il6)    05168 Herpes simplex virus 1 infection     101839443 (Il6)    05163 Human cytomegalovirus infection     101839443 (Il6)    05167 Kaposi sarcoma-associated herpesvirus infection     101839443 (Il6)    05169 Epstein-Barr virus infection     101839443 (Il6)   09171 Infectious disease: bacterial    05132 Salmonella infection     101839443 (Il6)    05135 Yersinia infection     101839443 (Il6)    05133 Pertussis     101839443 (Il6)    05134 Legionellosis     101839443 (Il6)    05152 Tuberculosis     101839443 (Il6)   09174 Infectious disease: parasitic    05146 Amoebiasis     101839443 (Il6)    05144 Malaria     101839443 (Il6)    05142 Chagas disease     101839443 (Il6)    05143 African trypanosomiasis     101839443 (Il6)   09163 Immune disease    05323 Rheumatoid arthritis     101839443 (Il6)    05321 Inflammatory bowel disease     101839443 (Il6)    05332 Graft-versus-host disease     101839443 (Il6)   09164 Neurodegenerative disease    05010 Alzheimer disease     101839443 (Il6)    05020 Prion disease     101839443 (Il6)    05022 Pathways of neurodegeneration - multiple diseases     101839443 (Il6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101839443 (Il6)    05410 Hypertrophic cardiomyopathy     101839443 (Il6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101839443 (Il6)    04932 Non-alcoholic fatty liver disease     101839443 (Il6)    04931 Insulin resistance     101839443 (Il6)    04933 AGE-RAGE signaling pathway in diabetic complications     101839443 (Il6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101839443 (Il6)    01523 Antifolate resistance     101839443 (Il6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:maua04052]     101839443 (Il6) Cytokines and neuropeptides [BR:maua04052]  Cytokines   Interleukins    101839443 (Il6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 IL23 GCSF Baculo_LEF-3 DUF5416 Motif Other DBs NCBI-GeneID:  101839443 NCBI-ProteinID:  XP_005087167 UniProt:  A0A1U7QW01 LinkDB All DBs Position Unknown AA seq 212 aa AA seqDB search MKFLSARDFHPLVFLGLLLVMATALPTSQVRRGDFTEDTTPNRPVYTTSQQVGGLVTYVL REIYELRKELCNNNPGCMDNDYVLLENNLELPVIQINDGCLQTGYNWEICLLKITSGLLD YQIYLEFVTNNVQDNKKDKARVIQSTIKTLSQIFKQEVKGPDKIVTPSPTSKAILMEKLE SQKEWPRTKTIKLILKALEEFLEVTMRSTRQN NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atgaagttcctctccgcaagagacttccatccacttgtcttcttgggactgctgctggtg atggccactgccctccctacctcacaagtccggagaggagacttcacagaggacactact cccaacagaccagtgtataccacttctcaacaagtcggaggtttggttacatatgtcctc agggaaatctacgaattgagaaaagagttgtgtaataacaaccctggctgtatggacaat gactatgtgttgttagaaaataatctggaacttccggtgatacaaataaatgatggatgc ctccaaactggatacaattgggaaatttgcctattgaaaatcacctctggtcttctggac taccagatctacctggagtttgtgacgaacaatgtacaagataacaagaaagacaaagcc agagtcattcagagcaccatcaaaaccctaagtcagatcttcaaacaagaggtaaagggt ccagataaaatagtcacgcctagcccaacctccaaggccatcctgatggagaagctggag tcacaaaaggagtggccaagaaccaagaccataaaactcatcctgaaagcacttgaagaa ttcctagaagtcaccatgaggtctactcggcaaaactag

DBGET integrated database retrieval system