Mesocricetus auratus (golden hamster): 101840942 Help Entry 101840942         CDS       T08306                                  Symbol Il10 Name (RefSeq) interleukin-10   KO K05443   interleukin 10 Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04060   Cytokine-cytokine receptor interaction maua04061   Viral protein interaction with cytokine and cytokine receptor maua04068   FoxO signaling pathway maua04148   Efferocytosis maua04625   C-type lectin receptor signaling pathway maua04630   JAK-STAT signaling pathway maua04660   T cell receptor signaling pathway maua04672   Intestinal immune network for IgA production maua05133   Pertussis maua05135   Yersinia infection maua05140   Leishmaniasis maua05142   Chagas disease maua05143   African trypanosomiasis maua05144   Malaria maua05145   Toxoplasmosis maua05146   Amoebiasis maua05150   Staphylococcus aureus infection maua05152   Tuberculosis maua05310   Asthma maua05320   Autoimmune thyroid disease maua05321   Inflammatory bowel disease maua05322   Systemic lupus erythematosus maua05330   Allograft rejection Brite KEGG Orthology (KO) [BR:maua00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101840942 (Il10)    04068 FoxO signaling pathway     101840942 (Il10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101840942 (Il10)    04061 Viral protein interaction with cytokine and cytokine receptor     101840942 (Il10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     101840942 (Il10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101840942 (Il10)    04660 T cell receptor signaling pathway     101840942 (Il10)    04672 Intestinal immune network for IgA production     101840942 (Il10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     101840942 (Il10)    05133 Pertussis     101840942 (Il10)    05150 Staphylococcus aureus infection     101840942 (Il10)    05152 Tuberculosis     101840942 (Il10)   09174 Infectious disease: parasitic    05146 Amoebiasis     101840942 (Il10)    05144 Malaria     101840942 (Il10)    05145 Toxoplasmosis     101840942 (Il10)    05140 Leishmaniasis     101840942 (Il10)    05142 Chagas disease     101840942 (Il10)    05143 African trypanosomiasis     101840942 (Il10)   09163 Immune disease    05310 Asthma     101840942 (Il10)    05322 Systemic lupus erythematosus     101840942 (Il10)    05320 Autoimmune thyroid disease     101840942 (Il10)    05321 Inflammatory bowel disease     101840942 (Il10)    05330 Allograft rejection     101840942 (Il10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:maua04052]     101840942 (Il10)    00536 Glycosaminoglycan binding proteins [BR:maua00536]     101840942 (Il10) Cytokines and neuropeptides [BR:maua04052]  Cytokines   Interleukins    101840942 (Il10) Glycosaminoglycan binding proteins [BR:maua00536]  Heparan sulfate / Heparin   Cytokines    101840942 (Il10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL10 IL22 RIN1 DUF2408 Motif Other DBs NCBI-GeneID:  101840942 NCBI-ProteinID:  XP_005079917 UniProt:  A0A1U7QIX2 LinkDB All DBs Position Unknown AA seq 178 aa AA seqDB search MLGSALLCCLLLLAGVGPSRGQYTQHESNCTHFPVSQTHMLRELRTAFSQVKTFFQKKDQ LDNILLTDSLLQDFKGYLGCQTLSEMIQFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLR RQLQRCHRFLPCENKSKAVEQVKDNFNKLQEKGVFKAMNEFDIFINCIEVYMTIKMKS NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgctcggctcagcactgctctgttgcctgctcttactggctggagtgggacccagcaga ggccagtacacccagcatgagagtaactgcacccacttcccagtcagccagacccacatg ctccgagagctgaggactgccttcagccaggtgaagactttctttcaaaagaaggaccag ctggacaacatactactcactgactccttactgcaggactttaagggttacttgggttgc caaaccttatcagaaatgatccagttttacctggtagaagtgatgccccaggcagagaac cacggcccagaaatcaaggagcatttgaactccctaggagagaagctgaagaccctcagg aggcaactgcagcgctgtcatcgatttctcccctgtgaaaataaaagcaaggctgtggaa caggtgaaggataactttaataagctccaagagaaaggcgtcttcaaggccatgaatgaa tttgacatcttcatcaactgcatagaagtgtacatgaccatcaaaatgaaaagctag

DBGET integrated database retrieval system