Mesocricetus auratus (golden hamster): 106022439 Help Entry 106022439         CDS       T08306                                  Name (RefSeq) CD209 antigen-like protein E   KO K06563   C-type lectin domain family 4 member L/M Organism maua  Mesocricetus auratus (golden hamster) Pathway maua03260   Virion - Human immunodeficiency virus maua03264   Virion - Flavivirus and Alphavirus maua03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus maua03273   Virion - Lassa virus and SFTS virus maua04145   Phagosome maua04625   C-type lectin receptor signaling pathway maua05152   Tuberculosis maua05162   Measles Brite KEGG Orthology (KO) [BR:maua00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     106022439    03264 Virion - Flavivirus and Alphavirus     106022439    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     106022439    03273 Virion - Lassa virus and SFTS virus     106022439  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     106022439  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106022439  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     106022439   09171 Infectious disease: bacterial    05152 Tuberculosis     106022439  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:maua04131]     106022439   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:maua04054]     106022439    04515 Cell adhesion molecules [BR:maua04515]     106022439    04090 CD molecules [BR:maua04090]     106022439    04091 Lectins [BR:maua04091]     106022439 Membrane trafficking [BR:maua04131]  Endocytosis   Phagocytosis    C-lectin receptors     106022439 Pattern recognition receptors [BR:maua04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    106022439 Cell adhesion molecules [BR:maua04515]  Lectins   Selectins and C-type lectins    106022439 CD molecules [BR:maua04090]  Proteins   106022439 Lectins [BR:maua04091]  C-Type lectins   Asialoglycoprotein and DC receptors    106022439 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Big_10 Motif Other DBs NCBI-GeneID:  106022439 NCBI-ProteinID:  XP_012980084 UniProt:  A0A1U8CXJ4 LinkDB All DBs Position Unknown AA seq 214 aa AA seqDB search MTVSDSKARVQQMGSLGFLDRGHIALVLQLLLLVLFAGLLAAIIIQVSKIPSSEEMQWEK TKQEKMYQDLSQLKSEVDSLCRHCPWDWTFFNGNCYFFSKSQRNWHDSITACQEVGAQLV VVKSHEEQSFLQQTSKKNGYTWMGLSDLNKEGAWYWLDDSPLSDRFGKYWNRGQPNNIGG QDCVEFRDEGWNDANCNDMKLWICKKSATTCSSK NT seq 645 nt NT seq  +upstreamnt  +downstreamnt atgactgtgagcgactccaaagcaagggtgcagcagatgggctctctggggtttctggac cgaggtcacattgccctggtgctgcagttgctgttactcgttctcttcgctggactcctg gccgccatcatcatccaagtttccaagatccccagctcagaggaaatgcaatgggaaaaa acaaagcaggagaaaatgtaccaggacctgagccaactgaagtctgaagttgatagcctc tgtcgccactgcccttgggattggacattcttcaatggaaactgttacttcttctccaag tcgcaacggaactggcatgactccatcactgcctgccaggaggtgggggcccagttggtc gtcgtcaaaagtcacgaggagcagagcttcctgcagcagacttccaagaaaaatggctac acctggatggggctgtcagacctgaacaaggaaggtgcatggtattggctggatgactca cctctgtcagacagatttgggaagtattggaatagaggacagcccaacaacattggggga caagactgtgtggaattcagagatgaaggctggaatgatgccaactgcaacgacatgaaa ttgtggatctgcaaaaaatctgcaactacctgttccagcaagtga

DBGET integrated database retrieval system