Mesocricetus auratus (golden hamster): 121144026 Help Entry 121144026         CDS       T08306                                  Symbol Ifnb1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04060   Cytokine-cytokine receptor interaction maua04151   PI3K-Akt signaling pathway maua04217   Necroptosis maua04380   Osteoclast differentiation maua04620   Toll-like receptor signaling pathway maua04621   NOD-like receptor signaling pathway maua04622   RIG-I-like receptor signaling pathway maua04623   Cytosolic DNA-sensing pathway maua04630   JAK-STAT signaling pathway maua04650   Natural killer cell mediated cytotoxicity maua04668   TNF signaling pathway maua04936   Alcoholic liver disease maua05135   Yersinia infection maua05142   Chagas disease maua05152   Tuberculosis maua05160   Hepatitis C maua05161   Hepatitis B maua05162   Measles maua05163   Human cytomegalovirus infection maua05164   Influenza A maua05165   Human papillomavirus infection maua05167   Kaposi sarcoma-associated herpesvirus infection maua05168   Herpes simplex virus 1 infection maua05169   Epstein-Barr virus infection maua05170   Human immunodeficiency virus 1 infection maua05171   Coronavirus disease - COVID-19 maua05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:maua00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     121144026 (Ifnb1)    04668 TNF signaling pathway     121144026 (Ifnb1)    04151 PI3K-Akt signaling pathway     121144026 (Ifnb1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121144026 (Ifnb1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     121144026 (Ifnb1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121144026 (Ifnb1)    04621 NOD-like receptor signaling pathway     121144026 (Ifnb1)    04622 RIG-I-like receptor signaling pathway     121144026 (Ifnb1)    04623 Cytosolic DNA-sensing pathway     121144026 (Ifnb1)    04650 Natural killer cell mediated cytotoxicity     121144026 (Ifnb1)   09158 Development and regeneration    04380 Osteoclast differentiation     121144026 (Ifnb1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     121144026 (Ifnb1)    05161 Hepatitis B     121144026 (Ifnb1)    05160 Hepatitis C     121144026 (Ifnb1)    05171 Coronavirus disease - COVID-19     121144026 (Ifnb1)    05164 Influenza A     121144026 (Ifnb1)    05162 Measles     121144026 (Ifnb1)    05168 Herpes simplex virus 1 infection     121144026 (Ifnb1)    05163 Human cytomegalovirus infection     121144026 (Ifnb1)    05167 Kaposi sarcoma-associated herpesvirus infection     121144026 (Ifnb1)    05169 Epstein-Barr virus infection     121144026 (Ifnb1)    05165 Human papillomavirus infection     121144026 (Ifnb1)   09171 Infectious disease: bacterial    05135 Yersinia infection     121144026 (Ifnb1)    05152 Tuberculosis     121144026 (Ifnb1)   09174 Infectious disease: parasitic    05142 Chagas disease     121144026 (Ifnb1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121144026 (Ifnb1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     121144026 (Ifnb1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:maua04052]     121144026 (Ifnb1) Cytokines and neuropeptides [BR:maua04052]  Cytokines   Interferons    121144026 (Ifnb1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  121144026 NCBI-ProteinID:  XP_040613111 UniProt:  A0ABM2YE99 LinkDB All DBs Position Unknown AA seq 180 aa AA seqDB search MTNRWILQAAFLLWFLPISLSINYEELEARQSRSNSECEDLLKQLRGPLCLRDRKFFKMP MEVNHPEQMEKRDTAFIIQEMLQNIFLVFNNTFSSTGWNKTIVESFLGKLHNQIVFLNET LKEVPEDESLTTRISLKSYYWQLGRYLKEKRYSSCAWMVTRAAVSRNFLIIRRLTWIFQS NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaggtggatccttcaagctgcatttctgctgtggtttctccccatatccctg tccatcaactacgaggaacttgaggccagacaaagcagaagcaattcagagtgtgaggac ctcctgaaacagctgcgtggacctctctgcctcagagacagaaagttcttcaagatgcct atggaggtgaaccacccagaacagatggagaagagagacactgccttcatcatccaagag atgctccagaatatctttcttgtcttcaacaacactttctccagcactgggtggaataag accatcgttgaaagtttcttaggtaaacttcacaatcagatagtctttctgaatgaaacc ctaaaggaagtgccagaggatgaaagtttgactacaaggattagcttgaagagctattac tggcagctgggaaggtaccttaaagagaagaggtacagcagctgcgcctggatggtgacc cgagcagcagtctcaaggaactttttaatcattagaaggctcacttggatcttccagagc tga

DBGET integrated database retrieval system