Drepanopeziza brunnea: MBM_08230 Help Entry MBM_08230         CDS       T03105                                  Name (RefSeq) ring-box 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism mbe  Drepanopeziza brunnea Pathway mbe03420   Nucleotide excision repair mbe04111   Cell cycle - yeast mbe04120   Ubiquitin mediated proteolysis mbe04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mbe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     MBM_08230    04120 Ubiquitin mediated proteolysis     MBM_08230   09124 Replication and repair    03420 Nucleotide excision repair     MBM_08230  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     MBM_08230  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mbe04121]     MBM_08230    03400 DNA repair and recombination proteins [BR:mbe03400]     MBM_08230 Enzymes [BR:mbe01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      MBM_08230 Ubiquitin system [BR:mbe04121]  Ubiquitin ligases (E3)   UBL E3 ligases    MBM_08230   Multi subunit type E3    SCF complex     Ring finger protein      MBM_08230    Cul2 complex      MBM_08230    Cul3 complex      MBM_08230    Cul4 complex      MBM_08230    Cul7 complex      MBM_08230    Cul8 complex      MBM_08230    Cul9 complex      MBM_08230 DNA repair and recombination proteins [BR:mbe03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       MBM_08230     TCR (transcription coupled repair) factors      Cul4-CSA complex       MBM_08230 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  18764165 NCBI-ProteinID:  XP_007296119 UniProt:  K1WMF8 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MADVDMTDAPSGSVAPTKKSAGKAKAGAEGGAGGKKRFEVKKWSAVALWAWDIVVDNCAI CRNHIMDLCIECQANQASATSEECTVAWGICNHAFHFHCISRWLKTRQVCPLDNRDWEFQ KYGR NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggcggatgtggatatgaccgatgctccctctggatctgtcgctcctacgaagaagagc gcgggcaaggccaaggccggggctgaaggaggggcaggtggcaagaagcgttttgaggtt aagaagtggtctgctgttgctctctgggcctgggatatcgtcgtcgacaactgtgccatc tgcagaaaccatatcatggatctctgtattgaatgtcaggccaatcaagcttctgctacc agcgaggagtgcacggtcgcctggggtatctgcaaccatgcctttcactttcactgtatt tcccgttggctgaagacgcgccaagtttgcccactggacaaccgagactgggagttccaa aagtacggtcgttaa

DBGET integrated database retrieval system