KEGG   Moschus berezovskii (Chinese forest musk deer): 129536468
Entry
129536468         CDS       T09065                                 
Symbol
IFNG
Name
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
mbez  Moschus berezovskii (Chinese forest musk deer)
Pathway
mbez03050  Proteasome
mbez04060  Cytokine-cytokine receptor interaction
mbez04066  HIF-1 signaling pathway
mbez04217  Necroptosis
mbez04350  TGF-beta signaling pathway
mbez04380  Osteoclast differentiation
mbez04612  Antigen processing and presentation
mbez04630  JAK-STAT signaling pathway
mbez04650  Natural killer cell mediated cytotoxicity
mbez04657  IL-17 signaling pathway
mbez04658  Th1 and Th2 cell differentiation
mbez04659  Th17 cell differentiation
mbez04660  T cell receptor signaling pathway
mbez04940  Type I diabetes mellitus
mbez05140  Leishmaniasis
mbez05142  Chagas disease
mbez05143  African trypanosomiasis
mbez05144  Malaria
mbez05145  Toxoplasmosis
mbez05146  Amoebiasis
mbez05152  Tuberculosis
mbez05160  Hepatitis C
mbez05164  Influenza A
mbez05168  Herpes simplex virus 1 infection
mbez05200  Pathways in cancer
mbez05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mbez05321  Inflammatory bowel disease
mbez05322  Systemic lupus erythematosus
mbez05323  Rheumatoid arthritis
mbez05330  Allograft rejection
mbez05332  Graft-versus-host disease
mbez05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mbez00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    129536468 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    129536468 (IFNG)
   04630 JAK-STAT signaling pathway
    129536468 (IFNG)
   04066 HIF-1 signaling pathway
    129536468 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    129536468 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    129536468 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    129536468 (IFNG)
   04612 Antigen processing and presentation
    129536468 (IFNG)
   04660 T cell receptor signaling pathway
    129536468 (IFNG)
   04658 Th1 and Th2 cell differentiation
    129536468 (IFNG)
   04659 Th17 cell differentiation
    129536468 (IFNG)
   04657 IL-17 signaling pathway
    129536468 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    129536468 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    129536468 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    129536468 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    129536468 (IFNG)
   05164 Influenza A
    129536468 (IFNG)
   05168 Herpes simplex virus 1 infection
    129536468 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    129536468 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    129536468 (IFNG)
   05144 Malaria
    129536468 (IFNG)
   05145 Toxoplasmosis
    129536468 (IFNG)
   05140 Leishmaniasis
    129536468 (IFNG)
   05142 Chagas disease
    129536468 (IFNG)
   05143 African trypanosomiasis
    129536468 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    129536468 (IFNG)
   05323 Rheumatoid arthritis
    129536468 (IFNG)
   05321 Inflammatory bowel disease
    129536468 (IFNG)
   05330 Allograft rejection
    129536468 (IFNG)
   05332 Graft-versus-host disease
    129536468 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    129536468 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    129536468 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mbez03051]
    129536468 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:mbez04052]
    129536468 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:mbez00536]
    129536468 (IFNG)
Proteasome [BR:mbez03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    129536468 (IFNG)
Cytokines and neuropeptides [BR:mbez04052]
 Cytokines
  Interferons
   129536468 (IFNG)
Glycosaminoglycan binding proteins [BR:mbez00536]
 Heparan sulfate / Heparin
  Cytokines
   129536468 (IFNG)
SSDB
Motif
Pfam: IFN-gamma API5 DotU
Other DBs
NCBI-GeneID: 129536468
NCBI-ProteinID: XP_055251404
LinkDB
Position
Unknown
AA seq 166 aa
MKYTSYFLALQLCLLLGFSGSYGQGPFFKEIENLKEYFNASNPDVATGGPLFLEILKNWK
EESDKKIIQSQIVSFYFKLFENFKDDQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKKLIQ
IPVDDLQIQRKAINELIKVMNDLLPKSNLRKRKRSQNLFRGRRASM
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaaatatacaagctatttcttggctttacagctctgcctgcttttgggtttttctggt
tcttatggccagggcccattttttaaagaaatagaaaacttaaaggagtattttaatgca
agtaacccagatgtggctacaggtgggcctcttttcttagaaattttgaagaattggaaa
gaggagagtgacaaaaaaattattcagagccaaattgtctccttctacttcaaactcttt
gaaaacttcaaagatgaccaggtcattcaaaggagcatggatatcatcaagcaagacatg
tttcagaagttcttgaatggcagctctgagaaactggaggacttcaaaaagctgattcaa
attccggtggatgatctgcagatccagcgcaaagccataaatgaactcatcaaagtgatg
aatgacctattgccaaaatctaacctcagaaagcggaagagaagtcagaatctctttcga
ggccggagagcatcaatgtaa

DBGET integrated database retrieval system