Moschus berezovskii (Chinese forest musk deer): 129536468
Help
Entry
129536468 CDS
T09065
Symbol
IFNG
Name
(RefSeq) interferon gamma
KO
K04687
interferon gamma
Organism
mbez
Moschus berezovskii (Chinese forest musk deer)
Pathway
mbez03050
Proteasome
mbez04060
Cytokine-cytokine receptor interaction
mbez04066
HIF-1 signaling pathway
mbez04217
Necroptosis
mbez04350
TGF-beta signaling pathway
mbez04380
Osteoclast differentiation
mbez04612
Antigen processing and presentation
mbez04630
JAK-STAT signaling pathway
mbez04650
Natural killer cell mediated cytotoxicity
mbez04657
IL-17 signaling pathway
mbez04658
Th1 and Th2 cell differentiation
mbez04659
Th17 cell differentiation
mbez04660
T cell receptor signaling pathway
mbez04940
Type I diabetes mellitus
mbez05140
Leishmaniasis
mbez05142
Chagas disease
mbez05143
African trypanosomiasis
mbez05144
Malaria
mbez05145
Toxoplasmosis
mbez05146
Amoebiasis
mbez05152
Tuberculosis
mbez05160
Hepatitis C
mbez05164
Influenza A
mbez05168
Herpes simplex virus 1 infection
mbez05200
Pathways in cancer
mbez05235
PD-L1 expression and PD-1 checkpoint pathway in cancer
mbez05321
Inflammatory bowel disease
mbez05322
Systemic lupus erythematosus
mbez05323
Rheumatoid arthritis
mbez05330
Allograft rejection
mbez05332
Graft-versus-host disease
mbez05418
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:
mbez00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
129536468 (IFNG)
09130 Environmental Information Processing
09132 Signal transduction
04350 TGF-beta signaling pathway
129536468 (IFNG)
04630 JAK-STAT signaling pathway
129536468 (IFNG)
04066 HIF-1 signaling pathway
129536468 (IFNG)
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
129536468 (IFNG)
09140 Cellular Processes
09143 Cell growth and death
04217 Necroptosis
129536468 (IFNG)
09150 Organismal Systems
09151 Immune system
04650 Natural killer cell mediated cytotoxicity
129536468 (IFNG)
04612 Antigen processing and presentation
129536468 (IFNG)
04660 T cell receptor signaling pathway
129536468 (IFNG)
04658 Th1 and Th2 cell differentiation
129536468 (IFNG)
04659 Th17 cell differentiation
129536468 (IFNG)
04657 IL-17 signaling pathway
129536468 (IFNG)
09158 Development and regeneration
04380 Osteoclast differentiation
129536468 (IFNG)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
129536468 (IFNG)
05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
129536468 (IFNG)
09172 Infectious disease: viral
05160 Hepatitis C
129536468 (IFNG)
05164 Influenza A
129536468 (IFNG)
05168 Herpes simplex virus 1 infection
129536468 (IFNG)
09171 Infectious disease: bacterial
05152 Tuberculosis
129536468 (IFNG)
09174 Infectious disease: parasitic
05146 Amoebiasis
129536468 (IFNG)
05144 Malaria
129536468 (IFNG)
05145 Toxoplasmosis
129536468 (IFNG)
05140 Leishmaniasis
129536468 (IFNG)
05142 Chagas disease
129536468 (IFNG)
05143 African trypanosomiasis
129536468 (IFNG)
09163 Immune disease
05322 Systemic lupus erythematosus
129536468 (IFNG)
05323 Rheumatoid arthritis
129536468 (IFNG)
05321 Inflammatory bowel disease
129536468 (IFNG)
05330 Allograft rejection
129536468 (IFNG)
05332 Graft-versus-host disease
129536468 (IFNG)
09166 Cardiovascular disease
05418 Fluid shear stress and atherosclerosis
129536468 (IFNG)
09167 Endocrine and metabolic disease
04940 Type I diabetes mellitus
129536468 (IFNG)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
mbez03051
]
129536468 (IFNG)
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:
mbez04052
]
129536468 (IFNG)
00536 Glycosaminoglycan binding proteins [BR:
mbez00536
]
129536468 (IFNG)
Proteasome [BR:
mbez03051
]
Eukaryotic proteasome
Assembling factors
Other assembling factors
129536468 (IFNG)
Cytokines and neuropeptides [BR:
mbez04052
]
Cytokines
Interferons
129536468 (IFNG)
Glycosaminoglycan binding proteins [BR:
mbez00536
]
Heparan sulfate / Heparin
Cytokines
129536468 (IFNG)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
IFN-gamma
API5
DotU
Motif
Other DBs
NCBI-GeneID:
129536468
NCBI-ProteinID:
XP_055251404
LinkDB
All DBs
Position
Unknown
AA seq
166 aa
AA seq
DB search
MKYTSYFLALQLCLLLGFSGSYGQGPFFKEIENLKEYFNASNPDVATGGPLFLEILKNWK
EESDKKIIQSQIVSFYFKLFENFKDDQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKKLIQ
IPVDDLQIQRKAINELIKVMNDLLPKSNLRKRKRSQNLFRGRRASM
NT seq
501 nt
NT seq
+upstream
nt +downstream
nt
atgaaatatacaagctatttcttggctttacagctctgcctgcttttgggtttttctggt
tcttatggccagggcccattttttaaagaaatagaaaacttaaaggagtattttaatgca
agtaacccagatgtggctacaggtgggcctcttttcttagaaattttgaagaattggaaa
gaggagagtgacaaaaaaattattcagagccaaattgtctccttctacttcaaactcttt
gaaaacttcaaagatgaccaggtcattcaaaggagcatggatatcatcaagcaagacatg
tttcagaagttcttgaatggcagctctgagaaactggaggacttcaaaaagctgattcaa
attccggtggatgatctgcagatccagcgcaaagccataaatgaactcatcaaagtgatg
aatgacctattgccaaaatctaacctcagaaagcggaagagaagtcagaatctctttcga
ggccggagagcatcaatgtaa
DBGET
integrated database retrieval system