KEGG   Macrococcus brunensis: MGG13_06480
Entry
MGG13_06480       CDS       T08179                                 
Name
(GenBank) hypothetical protein
  KO
K21274  hexaprenyl-diphosphate synthase small subunit [EC:2.5.1.83]
Organism
mbru  Macrococcus brunensis
Pathway
mbru00900  Terpenoid backbone biosynthesis
mbru01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbru00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGG13_06480
Enzymes [BR:mbru01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.83  hexaprenyl diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     MGG13_06480
SSDB
Motif
Pfam: PhoD_2
Other DBs
NCBI-ProteinID: ULG73364
LinkDB
Position
complement(1248897..1249346)
AA seq 149 aa
MDFYTQYKEDNLKLERRYPLYRCPAANADLVSILTRLSIADNIKKSILAIDSAMRLGRKV
DNHNKAHTILATDLLSAQFYHYNAEHFDQTTFRKLTECVKRYNLLMSAYDTSQDDALIPE
IEAVFVLPFVSIDDPTVQQLINHSELYTK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggatttttacacacagtacaaagaggacaacttaaaactggaaagacgctatcctctc
tatcgctgtccggcagcgaatgctgatctcgtcagtattctgactcgactttccatcgca
gacaatatcaagaaaagtatactggctattgattctgcaatgcgactcggtagaaaagta
gacaatcataataaagcacataccatactcgcaactgatctgctgagtgcacagttttat
cattataacgctgaacattttgatcagaccactttcagaaaactgacggaatgtgtgaaa
cgctataatcttctgatgtcggcttatgacacgtcacaggatgatgcgttaatacctgaa
atagaagctgtatttgttctgccttttgtttcaatagatgatccaactgtccagcagctg
atcaatcactctgaactctatactaaataa

DBGET integrated database retrieval system