KEGG   Methanosarcina barkeri Wiesmoor: MSBRW_1148
Entry
MSBRW_1148        CDS       T03839                                 
Name
(GenBank) Methylated-thiol--coenzyme M methyltransferase
  KO
K16954  methylthiol:coenzyme M methyltransferase [EC:2.1.1.251]
Organism
mbw  Methanosarcina barkeri Wiesmoor
Pathway
mbw00920  Sulfur metabolism
mbw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbw00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    MSBRW_1148
Enzymes [BR:mbw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.251  methylated-thiol---coenzyme M methyltransferase
     MSBRW_1148
SSDB
Motif
Pfam: URO-D
Other DBs
NCBI-ProteinID: AKB50401
UniProt: A0A0E3LKZ9
LinkDB
Position
1424911..1426014
AA seq 367 aa
MVSEMTPTRRVMAAVLGGRVDYVPPANPLAQTTTELMQICNASWPKAHFDSKMMADLAAA
PYEVCGIEAARPQFDISLEAEVLGCKLDWDKPDRPPVIGPAYTDPSNVTWPDNLEEAGRI
PVVLGAIEELRTRYDGMLPVIPLLTSPFTIASHIAGVENMAKWTKTAPEKAHAFIEAATD
FVIAYGKLQTIYGAHIVFLADPSASGDLISAETYREFVLPAHKRIAKEISCPQILHICGD
TSKLLPYIKQSGIDCFSFDAVPVSYCRQVVGNEMSILGSLDVIDLMPNGTPEQVYNRTRE
CILQGADIVGTSCGLSFGTSLENLRAYVRACKETQIPKCDDVEDLIRQIGIGIGKNMREN
VLGGMKE
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggtaagtgaaatgactccaacccgaagagttatggcagcagtgcttggaggtagggtt
gattacgtacccccagcgaatcccctcgctcagactacaactgaactgatgcagatatgc
aatgcttcctggccaaaagcccactttgacagcaagatgatggcagaccttgcagccgct
ccctatgaagtttgtggtatagaggctgcacgtccccagtttgacatttctctcgaagcg
gaggttctggggtgtaaacttgactgggacaaaccggacagacctcccgtaataggtcct
gcttataccgatccctccaatgtaacctggcctgacaatctggaagaagccggaagaatt
ccggtagtgctcggagcgattgaggaactgaggacgcgctatgacggcatgcttcctgtt
atcccactacttacatctccttttacgatagcaagtcatatagcaggcgtcgaaaacatg
gcaaagtggacaaagaccgctccagaaaaagcacatgccttcattgaggcagcaacagat
ttcgtgatagcttacgggaagctgcagactatttatggagcacacatcgtcttcctcgcc
gacccttcggcttccggggacctgatttctgcggaaacgtacagagaattcgtacttcct
gcccacaaaagaatagcaaaggaaatcagctgtccccagatcttgcacatctgcggagat
acaagtaaacttctgccctacataaaacagagtggaattgactgcttctccttcgatgcc
gttccggtctcgtattgccgtcaggtagtgggcaatgaaatgtccatcctcggaagcctg
gatgttatagatcttatgccaaacggcacccccgaacaggtttataacagaacaagggaa
tgcatcctgcagggagctgatattgttgggacttcgtgtggactctcatttggaacctcc
ctcgaaaatctcagggcatatgtcagggcttgtaaagagacacaaatcccgaaatgtgat
gatgtggaagaccttatcaggcagattggaatcggtattggaaagaatatgagagaaaac
gtgttgggtgggatgaaggaatga

DBGET integrated database retrieval system