KEGG   Mucisphaera calidilacus: Pan265_27890
Entry
Pan265_27890      CDS       T07838                                 
Symbol
neuA
Name
(GenBank) N-acylneuraminate cytidylyltransferase
  KO
K24307  5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
Organism
mcad  Mucisphaera calidilacus
Pathway
mcad00541  O-Antigen nucleotide sugar biosynthesis
mcad01100  Metabolic pathways
mcad01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:mcad00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    Pan265_27890 (neuA)
SSDB
Motif
Pfam: CTP_transf_3 NTP_transf_3 IspD
Other DBs
NCBI-ProteinID: QDU72913
UniProt: A0A518C106
LinkDB
Position
3331255..3331980
AA seq 241 aa
MSVKGDTSGGVLALILARAGSKGLPGKNELDVAGRPMLAWTVDCAREAACVERVVLTTDG
ERLAEMGRSLGVEVVERPGALADDTATVDAAARHAVTVLEAGGASYSEVVLLYGNVPVRP
SGLVDRAVSMLRETGCDSVQSVCGVGKAHPYWMKTLDETGRMSAYEANQVYRRQDLPPVY
LLDGGLIAVRRASLFVECAGEPHAFLGEDRRAVVTEPGEVIDIDTAADLAVAEAVLLSRG
D
NT seq 726 nt   +upstreamnt  +downstreamnt
atgagcgtgaagggtgatacgagcggcggtgtgctggcgttgatcctggcgcgtgcgggg
agcaagggtctgccgggcaagaacgagctggatgtcgcgggtcggccgatgctggcgtgg
acggtggactgtgcgcgcgaggcggcctgtgtggagcgcgtggtgttgacgacggatggc
gagcggctggccgagatgggtcgttcgctgggcgtggaggtggtggagcggcccggggct
ctggcggatgacacggcgaccgtggacgcggcggcgcggcacgcggtgacggtgttggag
gcgggcggggcgtcttattcggaggtggtgttgttgtacggcaacgtgccggtccggccg
agcggtctggtggatcgtgcggtgtcgatgctgcgcgagacgggctgcgattcggtgcag
tcggtgtgcggcgtgggcaaggcacacccgtactggatgaagaccctggatgagacgggg
cgtatgtcggcgtacgaggcgaatcaggtctaccggcgtcaggacctgcctccggtttac
ctgctggatggtgggttgatcgcggtgcgtcgtgcttcgctgtttgtggagtgtgcgggt
gagccgcacgcgtttctcggcgaggatcgtcgtgcggtggtgacggagccgggtgaggtg
attgatattgataccgcggcggatcttgcggttgcggaggcggtgttgctttcaaggggc
gactga

DBGET integrated database retrieval system