KEGG   Macrococcus canis: MCCS_13100
Entry
MCCS_13100        CDS       T04838                                 
Symbol
hexs-a
Name
(GenBank) Hexaprenyl-diphosphate synthase small subunit ((2E,6E)-farnesyl-diphosphate specific)
  KO
K21274  hexaprenyl-diphosphate synthase small subunit [EC:2.5.1.83]
Organism
mcak  Macrococcus canis
Pathway
mcak00900  Terpenoid backbone biosynthesis
mcak01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcak00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MCCS_13100 (hexs-a)
Enzymes [BR:mcak01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.83  hexaprenyl diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     MCCS_13100 (hexs-a)
SSDB
Motif
Pfam: DUF5398
Other DBs
NCBI-ProteinID: ARQ06953
UniProt: A0A1W7ABG2
LinkDB
Position
complement(1253254..1253685)
AA seq 143 aa
MNYLVNLENQINELKNRYAYFQMIQFNQEIIDIVSDLELDDNVKSAIVVIDTSMRMQNVI
NDSNKDRLVLSTDILSALFYRYLSQPFLQDDFKVLTRCVTRINELKEIRSTVTEQQKLTE
IDQEIHYMFVQPYMNDEKVVAYE
NT seq 432 nt   +upstreamnt  +downstreamnt
atgaattatttagttaacctagaaaatcagatcaatgaactaaaaaatcgatatgcttat
tttcagatgattcaatttaatcaggaaatcatcgatattgttagtgaccttgagttagac
gataatgtgaaaagtgcaattgttgttattgatacaagtatgcgtatgcaaaatgtgatc
aacgatagtaacaaagacaggctcgtactatctactgatatattgagtgcattattttat
cgctatttatcgcagccgtttttacaagatgattttaaagtattaacgcgatgtgttaca
cgcatcaatgaactgaaagaaatacgttcaacggtaactgaacaacaaaaattaacagaa
atagatcaggaaattcattatatgtttgtacaaccctatatgaatgatgagaaagtggtg
gcttatgagtaa

DBGET integrated database retrieval system