Mus caroli (Ryukyu mouse): 110285451 Help Entry 110285451         CDS       T05910                                  Symbol Pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal03030   DNA replication mcal03410   Base excision repair mcal03420   Nucleotide excision repair mcal03430   Mismatch repair mcal03440   Homologous recombination Brite KEGG Orthology (KO) [BR:mcal00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     110285451 (Pold4)    03410 Base excision repair     110285451 (Pold4)    03420 Nucleotide excision repair     110285451 (Pold4)    03430 Mismatch repair     110285451 (Pold4)    03440 Homologous recombination     110285451 (Pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mcal03032]     110285451 (Pold4)    03400 DNA repair and recombination proteins [BR:mcal03400]     110285451 (Pold4) DNA replication proteins [BR:mcal03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     110285451 (Pold4) DNA repair and recombination proteins [BR:mcal03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       110285451 (Pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      110285451 (Pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 DUF6965 Motif Other DBs NCBI-GeneID:  110285451 NCBI-ProteinID:  XP_021007292 Ensembl:  MGP_CAROLIEiJ_G0022501 UniProt:  A0A6P5NYH7 LinkDB All DBs Position 19:977883..979599 Genome browser AA seq 107 aa AA seqDB search MGRKRFITDSYPVVKKREGPPGHSKGELAPELGEDTQSLSQEETELELLRQFDLAWQYGP CTGITRLQRWRRAEQMGLKPPLEVYQVLKAHPEDPHFQCSLWHLYPL NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgggtcggaagcggttcatcactgactcctatcctgttgtgaagaagagggaggggccc cctgggcacagcaagggagagctggcacccgagctaggggaagacacccagtccctcagc caggaggaaacagagctggagctgctgaggcagtttgacctggcctggcagtatgggcct tgtacaggtatcacaaggctgcagcgctggcgtcgggcagagcagatgggcttgaagccc cccctagaggtgtaccaagtgttgaaggcacaccctgaagaccctcacttccaatgcagc ctgtggcatctctacccactctaa

DBGET integrated database retrieval system