Mus caroli (Ryukyu mouse): 110287372 Help Entry 110287372         CDS       T05910                                  Name (RefSeq) elongin-C-like isoform X1   KO K03872   elongin-C Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04066   HIF-1 signaling pathway mcal04120   Ubiquitin mediated proteolysis mcal05170   Human immunodeficiency virus 1 infection mcal05200   Pathways in cancer mcal05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:mcal00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     110287372  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     110287372  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110287372   09162 Cancer: specific types    05211 Renal cell carcinoma     110287372   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110287372  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mcal04121]     110287372    03400 DNA repair and recombination proteins [BR:mcal03400]     110287372 Ubiquitin system [BR:mcal04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      110287372    Cul5 complex      110287372 DNA repair and recombination proteins [BR:mcal03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      110287372 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  110287372 NCBI-ProteinID:  XP_029329442 Ensembl:  MGP_CAROLIEiJ_G0012538 UniProt:  A0A6P7QMD3 LinkDB All DBs Position X:9111562..9121503 Genome browser AA seq 116 aa AA seqDB search MEERLSEEKTYGGFDGHDATMYMRLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENE TNEVNFREIPSHVLSKVCVYFIYKVHYTNSSTEIPEFPAAPETSLELLMATNFPDC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaagagagactctcagaggagaaaacctatggtggctttgatggccatgatgctact atgtatatgagattaatatcttctgatggtcatgaatttattgtaaaaagagaacatgca ttaacatcaggaacaataaaggccatgctgagtggtccaggtcagtttgcggagaatgaa accaacgaggtcaattttagagagatcccttcacatgtgctatcaaaagtgtgtgtgtat tttatctacaaggtccactatactaacagctctactgaaattcctgaatttccagctgca cctgaaacttcattggaacttctgatggccacaaacttcccagattgttaa

DBGET integrated database retrieval system