Mus caroli (Ryukyu mouse): 110289342 Help Entry 110289342         CDS       T05910                                  Symbol Cd59 Name (RefSeq) CD59 glycoprotein   KO K04008   CD59 antigen Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04610   Complement and coagulation cascades mcal04640   Hematopoietic cell lineage Brite KEGG Orthology (KO) [BR:mcal00001]  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     110289342 (Cd59)    04610 Complement and coagulation cascades     110289342 (Cd59)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcal04147]     110289342 (Cd59)    04090 CD molecules [BR:mcal04090]     110289342 (Cd59)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]     110289342 (Cd59) Exosome [BR:mcal04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110289342 (Cd59)   Exosomal proteins of other body fluids (saliva and urine)    110289342 (Cd59)   Exosomal proteins of colorectal cancer cells    110289342 (Cd59) CD molecules [BR:mcal04090]  Proteins   110289342 (Cd59) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcal00537]  Antigens   110289342 (Cd59) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Motif Other DBs NCBI-GeneID:  110289342 NCBI-ProteinID:  XP_021011162 UniProt:  A0A6P5PE01 LinkDB All DBs Position 2:97563529..97581094 Genome browser AA seq 123 aa AA seqDB search MRAQRGLILLLLLLAVFCSTAVSLKCYHCLDPVVSSCNMNSTCSPTQDTCLYAVSGMQVY QQCWKRSDCHTEVIMNLLEVAKVKFRCCQFNLCNKSEGSLGKTALLGTTVLVAILNLCFL SHL NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgagagctcagaggggactcatcttacttctgcttcttctggctgtcttctgttccaca gctgttagcctcaaatgctaccactgtttagacccggtggtttcttcatgcaatatgaac agcacttgctctcctacccaggatacctgtctctacgctgtatccggaatgcaagtgtat caacagtgttggaaacgttcagattgtcatactgaggtcattatgaacctattagaagtg gctaaagtaaaattcagatgctgccagtttaacttgtgtaacaaaagtgaaggatcattg gggaagacagcattgctggggaccacggttctggtggccattttgaatctttgtttctta agtcatctctaa

DBGET integrated database retrieval system