Mus caroli (Ryukyu mouse): 110291635 Help Entry 110291635         CDS       T05910                                  Symbol S100a10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04382   Cornified envelope formation mcal05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mcal00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     110291635 (S100a10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110291635 (S100a10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcal04147]     110291635 (S100a10) Exosome [BR:mcal04147]  Exosomal proteins   Exosomal proteins of microglial cells    110291635 (S100a10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 Motif Other DBs NCBI-GeneID:  110291635 NCBI-ProteinID:  XP_021014529 Ensembl:  MGP_CAROLIEiJ_G0025304 UniProt:  A0A6P5PM74 LinkDB All DBs Position 3:87725350..87734838 Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMLTFHRFAGDKDHLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFLSLVAGLTIACNDYFVVNMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatcccaaatggagcacgccatggaaaccatgatgcttacgtttcacaggtttgca ggcgacaaagaccatttgacaaaggaggacctgagagtgctcatggaacgggagttccct gggtttttggaaaatcaaaaggaccctctggctgtggacaaaatcatgaaggacctggac cagtgtcgagatggcaaagtgggcttccagagctttctatcactagtggcggggctcacc attgcatgcaatgactattttgtagtaaacatgaagcagaaggggaagaagtag

DBGET integrated database retrieval system