Mus caroli (Ryukyu mouse): 110293037 Help Entry 110293037         CDS       T05910                                  Symbol Ppp3r2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04010   MAPK signaling pathway mcal04020   Calcium signaling pathway mcal04022   cGMP-PKG signaling pathway mcal04114   Oocyte meiosis mcal04218   Cellular senescence mcal04310   Wnt signaling pathway mcal04360   Axon guidance mcal04370   VEGF signaling pathway mcal04380   Osteoclast differentiation mcal04625   C-type lectin receptor signaling pathway mcal04650   Natural killer cell mediated cytotoxicity mcal04658   Th1 and Th2 cell differentiation mcal04659   Th17 cell differentiation mcal04660   T cell receptor signaling pathway mcal04662   B cell receptor signaling pathway mcal04720   Long-term potentiation mcal04724   Glutamatergic synapse mcal04921   Oxytocin signaling pathway mcal04922   Glucagon signaling pathway mcal04924   Renin secretion mcal05010   Alzheimer disease mcal05014   Amyotrophic lateral sclerosis mcal05020   Prion disease mcal05022   Pathways of neurodegeneration - multiple diseases mcal05031   Amphetamine addiction mcal05152   Tuberculosis mcal05163   Human cytomegalovirus infection mcal05166   Human T-cell leukemia virus 1 infection mcal05167   Kaposi sarcoma-associated herpesvirus infection mcal05170   Human immunodeficiency virus 1 infection mcal05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mcal05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcal00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110293037 (Ppp3r2)    04310 Wnt signaling pathway     110293037 (Ppp3r2)    04370 VEGF signaling pathway     110293037 (Ppp3r2)    04020 Calcium signaling pathway     110293037 (Ppp3r2)    04022 cGMP-PKG signaling pathway     110293037 (Ppp3r2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     110293037 (Ppp3r2)    04218 Cellular senescence     110293037 (Ppp3r2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110293037 (Ppp3r2)    04650 Natural killer cell mediated cytotoxicity     110293037 (Ppp3r2)    04660 T cell receptor signaling pathway     110293037 (Ppp3r2)    04658 Th1 and Th2 cell differentiation     110293037 (Ppp3r2)    04659 Th17 cell differentiation     110293037 (Ppp3r2)    04662 B cell receptor signaling pathway     110293037 (Ppp3r2)   09152 Endocrine system    04922 Glucagon signaling pathway     110293037 (Ppp3r2)    04921 Oxytocin signaling pathway     110293037 (Ppp3r2)    04924 Renin secretion     110293037 (Ppp3r2)   09156 Nervous system    04724 Glutamatergic synapse     110293037 (Ppp3r2)    04720 Long-term potentiation     110293037 (Ppp3r2)   09158 Development and regeneration    04360 Axon guidance     110293037 (Ppp3r2)    04380 Osteoclast differentiation     110293037 (Ppp3r2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     110293037 (Ppp3r2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110293037 (Ppp3r2)    05170 Human immunodeficiency virus 1 infection     110293037 (Ppp3r2)    05163 Human cytomegalovirus infection     110293037 (Ppp3r2)    05167 Kaposi sarcoma-associated herpesvirus infection     110293037 (Ppp3r2)   09171 Infectious disease: bacterial    05152 Tuberculosis     110293037 (Ppp3r2)   09164 Neurodegenerative disease    05010 Alzheimer disease     110293037 (Ppp3r2)    05014 Amyotrophic lateral sclerosis     110293037 (Ppp3r2)    05020 Prion disease     110293037 (Ppp3r2)    05022 Pathways of neurodegeneration - multiple diseases     110293037 (Ppp3r2)   09165 Substance dependence    05031 Amphetamine addiction     110293037 (Ppp3r2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110293037 (Ppp3r2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mcal01009]     110293037 (Ppp3r2) Protein phosphatases and associated proteins [BR:mcal01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      110293037 (Ppp3r2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Toprim_3 Toprim_2 Motif Other DBs NCBI-GeneID:  110293037 NCBI-ProteinID:  XP_021016444 Ensembl:  MGP_CAROLIEiJ_G0026017 UniProt:  A0A6P5PFR0 LinkDB All DBs Position 4:complement(43592492..43593523) Genome browser AA seq 179 aa AA seqDB search MGNEASYQTELCNHFDQEEIRRLGKSFRKLDLDKSGSLSIEEFMRLPELQQNPLVGRVID IFDTDGNGEVDFHEFIVGTSQFSVKGDEEQKLRFAFRIYDMDNDGFISNGELFQVLKMMV GNNLKDWQLQQLVDKSILVLDKDGDGRISFEEFSDVVKTMEIHKKLVVFVEHGQEDLNA NT seq 540 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggccagctaccaaactgagctgtgcaaccacttcgaccaggaagagatc agaaggctgggtaaaagcttcaggaagctggacttggacaaatcgggctccctgagcata gaagagttcatgaggctgcctgagctgcagcagaatccgctggtgggccgagtgatcgac atcttcgacacagacggcaacggggaagtggacttccacgagttcatcgtgggcacctcc cagttcagcgtcaagggtgatgaagagcagaagctaaggttcgccttcagaatctacgac atggataatgatggtttcatctccaatggggagctcttccaggtgcttaagatgatggtg ggaaacaacctcaaggactggcagctgcagcagctggtggacaagagcatcttggtcctg gataaggatggcgatggccggatatcctttgaagagttcagtgatgtggtcaaaaccatg gagatccacaagaaattggtcgtgtttgtagaacacggtcaagaagacttaaacgcttaa

DBGET integrated database retrieval system