Mus caroli (Ryukyu mouse): 110293569 Help Entry 110293569         CDS       T05910                                  Name (RefSeq) ubiquitin-like   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal03010   Ribosome mcal04120   Ubiquitin mediated proteolysis mcal04137   Mitophagy - animal mcal04140   Autophagy - animal mcal05012   Parkinson disease mcal05022   Pathways of neurodegeneration - multiple diseases mcal05167   Kaposi sarcoma-associated herpesvirus infection mcal05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:mcal00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     110293569   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     110293569  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110293569    04137 Mitophagy - animal     110293569  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     110293569    05167 Kaposi sarcoma-associated herpesvirus infection     110293569   09164 Neurodegenerative disease    05012 Parkinson disease     110293569    05022 Pathways of neurodegeneration - multiple diseases     110293569  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mcal03011]     110293569    04121 Ubiquitin system [BR:mcal04121]     110293569   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcal04147]     110293569 Ribosome [BR:mcal03011]  Ribosomal proteins   Eukaryotes    Small subunit     110293569   Archaea     110293569 Ubiquitin system [BR:mcal04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    110293569 Exosome [BR:mcal04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110293569   Exosomal proteins of colorectal cancer cells    110293569 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ribosomal_S27 Rad60-SLD Rad60-SLD_2 Ubiquitin_2 DUF755 Dsc3_N FAD_binding_6 Motif Other DBs NCBI-GeneID:  110293569 NCBI-ProteinID:  XP_021017100 UniProt:  A0A6P5PLX2 LinkDB All DBs Position 4:complement(124960946..124961383) Genome browser AA seq 145 aa AA seqDB search MQIFLKTLMGKAITLEVEPSDTIDNVKAKTQDKEGIPPGKQRLIFAGKQLKDSRTLSDYN IQKESTLLHLVLRLQGGAKKRKKSYTKKSKHKKKKVKLAVLKYYKVDGNGKISQHRREYP SDECGAGVFKGSHFDRHSCGKGCLT NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgcagatttttctgaagacccttatggggaaggccatcacgctggaggttgaaccctcg gacactatagataatgtaaaggccaagacccaggataaggaaggaattcctcctggtaag cagaggctgatcttcgctggtaagcagctgaaagatagccgtactttgtctgactacaac attcaaaaggagtccacccttcttcaccttgtgttgagacttcagggtggtgctaagaaa aggaagaagtcttacaccaaaaagagtaagcataagaagaagaaggttaagttggctgtg ctgaaatattataaggtggatggaaatggcaaaatcagccaacatcgtcgagagtatcct tctgatgagtgtggtgctggagttttcaagggtagccactttgacaggcattcctgtggc aagggttgtctgacttaa

DBGET integrated database retrieval system