Mus caroli (Ryukyu mouse): 110295700 Help Entry 110295700         CDS       T05910                                  Symbol Rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04137   Mitophagy - animal mcal04140   Autophagy - animal mcal04144   Endocytosis mcal04145   Phagosome mcal04148   Efferocytosis mcal05132   Salmonella infection mcal05146   Amoebiasis mcal05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mcal00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110295700 (Rab7a)    04145 Phagosome     110295700 (Rab7a)    04140 Autophagy - animal     110295700 (Rab7a)    04137 Mitophagy - animal     110295700 (Rab7a)    04148 Efferocytosis     110295700 (Rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110295700 (Rab7a)    05152 Tuberculosis     110295700 (Rab7a)   09174 Infectious disease: parasitic    05146 Amoebiasis     110295700 (Rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcal04131]     110295700 (Rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcal04147]     110295700 (Rab7a)    04031 GTP-binding proteins [BR:mcal04031]     110295700 (Rab7a) Membrane trafficking [BR:mcal04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     110295700 (Rab7a) Exosome [BR:mcal04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110295700 (Rab7a)   Exosomal proteins of other body fluids (saliva and urine)    110295700 (Rab7a)   Exosomal proteins of colorectal cancer cells    110295700 (Rab7a)   Exosomal proteins of bladder cancer cells    110295700 (Rab7a) GTP-binding proteins [BR:mcal04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     110295700 (Rab7a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_7 NTPase_1 AAA_16 AAA_22 AAA_24 AAA_5 G-alpha ATPase_2 NACHT ABC_tran AAA_14 NB-ARC SRPRB ATP-synt_ab MCM Motif Other DBs NCBI-GeneID:  110295700 NCBI-ProteinID:  XP_029334677 UniProt:  A0A6P7R252 LinkDB All DBs Position 6:complement(84100352..84110840) Genome browser AA seq 189 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQVGLR ALKLQGALW NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggtcatcatcctgggagactctggtgttgga aagacatctctcatgaaccagtatgtgaataagaagttcagtaaccagtacaaagccaca ataggagcggactttctgaccaaggaggtgatggtggatgacagacttgttaccatgcag atctgggacacagccggtcaagaacggttccagtctcttggtgtggccttctacagaggt gcagattgctgtgttctggtgtttgatgtgactgcccccaacactttcaaaaccctcgac agctggagagacgagtttctcatccaggccagcccccgggatcccgagaacttccctttt gttgtgttgggaaacaagattgacctggaaaacagacaagtggccacaaagagggcacag gcttggtgctacagcaaaaacaacattccttacttcgagaccagtgccaaggaggccatc aatgtggagcaggccttccagacgattgctcggaacgctcttaaacaggtgggtctcagg gccctcaagctgcaaggcgccctctggtga

DBGET integrated database retrieval system