Mus caroli (Ryukyu mouse): 110296051 Help Entry 110296051         CDS       T05910                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04613   Neutrophil extracellular trap formation mcal05034   Alcoholism mcal05202   Transcriptional misregulation in cancer mcal05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcal00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110296051  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     110296051   09163 Immune disease    05322 Systemic lupus erythematosus     110296051   09165 Substance dependence    05034 Alcoholism     110296051  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcal03036]     110296051   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcal04147]     110296051 Chromosome and associated proteins [BR:mcal03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110296051 Exosome [BR:mcal04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110296051 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S TFIID-31kDa Motif Other DBs NCBI-GeneID:  110296051 NCBI-ProteinID:  XP_021020219 UniProt:  A0A6P5PPQ4 LinkDB All DBs Position 6:complement(110874093..110874576) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVVLREIRCYQKSPE LLIRKLPFQRLVQEIAQDFKTDLRFQSATIGALQEASEAYLVGLFEDTNLCAIHAKPVTI MPKDIQLALRTLRERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgctcgcaaatccaccggtggtaaagcacccaggaaacaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggtactccgtgaaatcagatgctatcagaagtcccctgaa cttctgatccgcaagctcccctttcagcgtctggtgcaagaaattgctcaggacttcaaa acagatctgcgcttccagagtgcaactattggtgctttgcaggaggcaagtgaggcttat ctggttggcctttttgaagataccaatctgtgtgctatccatgccaaacctgtaacaatt atgccaaaagatatccagctagcactccgcacactcagagaacgtgcttaa

DBGET integrated database retrieval system