KEGG   Mus caroli (Ryukyu mouse): 110298506
Entry
110298506         CDS       T05910                                 
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04610  Complement and coagulation cascades
mcal04810  Regulation of actin cytoskeleton
mcal05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110298506
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110298506
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110298506
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mcal04515]
    110298506
   04090 CD molecules [BR:mcal04090]
    110298506
Cell adhesion molecules [BR:mcal04515]
 Integrins
  Integrin alpha subunits
   110298506
CD molecules [BR:mcal04090]
 Proteins
  110298506
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE
Other DBs
NCBI-GeneID: 110298506
NCBI-ProteinID: XP_021023460
Ensembl: MGP_CAROLIEiJ_G0030538
LinkDB
Position
7:130154957..130176986
AA seq 1170 aa
MSCTWIAFLLLLGFVSCLGFNLDAEKPTHFHMDGAEFGHSVLQYDSSWVVVGAPKEIKAT
NQRGGLYKCGYHTGNCEPISLQVPPEAVNMSLGLSLAAATNPSRLLACGPTVHHTCRENT
YLTGLCFLLSSPFQQKQNFPTAQQECPRQDQDIVFLIDGSGSISSTDFGKMLDFVKAVMS
QLQRPSTRFSLMQFSHYFRVHFTFNDFISMSSPLSLLDSVRQLGGYTYTASAIKHVITEL
FTTQSGARQDATKVLIVITDGKKERDKLNYDSVIPMAEAAGIIRYAIGVGKAFYNTHSKQ
ELKAIASMPSHEYVFSVENFDALKDIENQLKEKIFAIEGTETPSSSSFELEMSQEGFSAV
FTPDGPVLGAVGSFSWSGGAFLYPSNMRPTFINMSQENEDMRDAYMGYSTELAFWKGVHS
LILGAPRHQHTGKVVIFTQESRHWRPKSEVRGTQIGSYFGASLCSVDMDRDGSTDLVLIG
APHYYEHTRGGQVSVCPMPGVRSRWHCGATLHGEQGHPWGRFGAALTVLGDVNGDSLADV
AIGAPGEEENRGAVYIFHGASRQDIAPSPSQRISASRISSRLQYFGQSLSGGQDLTRDGL
VDLAVGSKGHVLLLRTRPILRVSPTVYFTPAEISRSVFECQEQVTPEQTVGDATVCLHIH
ESPKTQLGDLQSTVTFDLALDHGRLSPRVIFKETKSRALTRVKTLGLNKHCESVTLLLPA
CVEDSVTPITLRLNFSLVGVPISSLQNLQPMLAVDDQTYFTASLPFEKNCGADHICQDDL
SVIFGFPDLKTLVVGSDLELNVDVTVSNDGEDSYGTTVTLFYPMGLSFRRVAEGQVFLRK
KENQQWQRRGQHSLHLMCDSTPDRSQGLWSTSCSIRHVIFRGGSQMTFLATFDVSPKAEL
GDRLLLRARVRSENNVPGTQKTTFQLELPVKYAVYTMISSHDQFTKYLNFSTSEKEKTSV
VEHRFQVNNLGQRDVPVSINFWVPVELKGEAVWTVTVSHPQNPFTQCYRNRLKPTQFDLL
THMQKSPVLDCAIADCLHLRCDIPSLGILDELDFILKGNLSFGWISQTLQKKVLLLSEAE
ITFNTSVYSQMPGQEAFLRAQTKTVLEMYKVHNPIPLIVGSSVGGLLLLAIITAILYKAG
FFKRQYKEMLEEANGQFVSENGTPTPQVAQ
NT seq 3513 nt   +upstreamnt  +downstreamnt
atgagctgtacctggatagcctttcttctgctgttggggtttgtttcttgtcttggcttc
aacttggacgcagaaaagccgacacattttcacatggacggtgctgagttcggacacagt
gtgctccagtatgatagctcctgggtggtggttggagcgccaaaggaaataaaagccact
aaccaaagaggtggcctctacaaatgtggctatcacacaggcaactgtgagcccatctcc
ctccaggtgcccccagaggctgtgaacatgtccctgggcctgtccctcgctgctgccacc
aacccttcccggctgttggcttgtggtcctactgtgcaccacacatgcagagagaataca
tacttgacagggctctgctttctactgagttcaccattccagcagaaacagaacttccca
actgcacagcaagagtgtccaaggcaagaccaagacatcgtgttcctgattgatggctcg
ggtagcatcagttccacagattttggaaaaatgctggactttgttaaagctgtgatgagc
cagcttcagagacctagcacacggttctccctgatgcagttctctcattacttccgagta
cattttactttcaacgacttcatctccatgtcaagccctttaagtctgttggattctgta
agacagctaggagggtacacatacacagcctcggctatcaagcacgtcataacagaactg
ttcaccacccaaagtggagctcggcaagatgccaccaaggtcctcattgtcatcactgat
gggaaaaaagaaagggacaagttgaattatgatagtgtcatccccatggcagaggctgca
ggcatcattcgttatgcaattggggtaggaaaggccttttacaacacacattccaagcaa
gaattaaaggccattgcatcgatgccttcccatgaatacgtattcagcgtggagaacttt
gatgctttgaaggatattgagaatcagctgaaggagaagatctttgccattgagggtaca
gagacaccaagcagcagttcttttgaattggagatgtcccaggagggcttcagtgctgtg
tttacacctgatggaccagttctgggggctgtgggaagcttcagctggtctggaggtgcc
ttcttgtacccctcaaatatgagacccaccttcatcaacatgtctcaggagaacgaggac
atgagggacgcttacatgggttactccactgaactggccttttggaagggggtccacagc
ctgatcctgggggcccctcgccaccagcacacggggaaggttgtcatctttacccaggaa
tccaggcactggaggcccaagtctgaagtcagagggacacagatcggctcctactttgga
gcatctctctgctctgtggacatggatagagatggcagcactgacctggtcctgatcgga
gccccccattactatgagcacacccgaggggggcaggtgtcagtgtgccccatgcccggt
gtgaggagcaggtggcattgtggggccaccctccatggggagcagggccatccttggggc
cgctttggagcggctctgacagtgctaggggacgtgaatggggacagtctggcggatgtg
gctattggtgcacccggagaggaggagaacagaggtgctgtctacatatttcatggagcc
tcgagacaggacatcgctccctcacccagccagaggatttcagcatcccggatctcctcc
aggcttcaatattttgggcagtcactgagtgggggccaggacctcacccgggatggactg
gtggatctggccgtgggctccaagggacacgtgctgctgctcaggaccagaccgattctt
agagtgtcaccaactgtttacttcacacctgcagagatttccaggtctgtgtttgagtgt
caggagcaggtgacccctgagcagacagtgggtgatgccactgtctgccttcatattcat
gaaagccccaagacccaactaggtgacctccaaagtactgtcacctttgatctggctcta
gaccatggccgtctgagtccccgggtcatcttcaaggagacaaagtcccgggctctgact
cgagttaaaactcttggtctgaacaagcactgtgaaagtgtgacgttgcttctcccggcc
tgtgtggaggactctgtgaccccgatcactcttcgcctcaacttttctcttgttggtgtg
cctatcagttccttacaaaatctccaacccatgctggctgtagatgaccaaacgtacttc
acggcctctcttccctttgagaagaactgtggagctgaccacatctgccaggatgacctt
agtgtcatatttggcttcccagacttgaagaccctggtggtgggaagtgacctggagctg
aatgtagatgtgacggtgtctaatgatggagaagattcttatggaaccacagtcactctg
ttctaccccatgggtctgtcctttagacgagttgcagaaggccaagtattccttcggaag
aaagagaaccagcagtggcagcggcgtgggcagcactccctgcacctcatgtgtgacagc
accccagacaggagtcagggcctctggagtaccagctgtagcatcagacatgtcattttc
cgtggaggctcacagatgacttttttggcaacttttgacgtctcccccaaagctgagctg
ggggaccggctgcttctaagagccagagtgagaagtgagaataatgtacctgggacccaa
aaaaccaccttccagttggagcttccagtaaaatacgcggtgtacaccatgatcagcagc
catgaccagtttaccaagtatcttaacttctcaacctcagaaaaggagaagaccagtgtg
gtcgaacatagattccaggtgaataatctgggacagagagacgtgccagtcagcatcaac
ttttgggtgcccgtagagctgaagggagaagctgtgtggacagtgacggtctcccaccct
cagaacccattcacccaatgctatcggaatagactcaagccaacacaatttgacctcttg
actcacatgcaaaagagtcccgtgctggactgcgccatcgccgactgcctgcacctccgt
tgtgacatcccctccttgggcatcctggatgagcttgacttcattctgaagggcaacctc
agcttcggctggatcagtcagacattgcagaaaaaagtgttgctcctgagtgaggctgaa
atcacattcaacacatctgtgtattcccagatgccgggacaggaggcatttctgagagcc
cagacgaagacagtgctggagatgtataaagttcacaaccccatccctcttatcgtgggc
agctcagtgggaggtctgctgctgctggctatcatcacagctatactttacaaggctggt
ttcttcaaacgtcagtacaaggagatgttggaggaagcaaatggacagtttgtctcagaa
aacgggaccccaactccccaggttgcccagtga

DBGET integrated database retrieval system