Mus caroli (Ryukyu mouse): 110300080 Help Entry 110300080         CDS       T05910                                  Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04978   Mineral absorption Brite KEGG Orthology (KO) [BR:mcal00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     110300080  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mcal03019]     110300080    03029 Mitochondrial biogenesis [BR:mcal03029]     110300080 Messenger RNA biogenesis [BR:mcal03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      110300080 Mitochondrial biogenesis [BR:mcal03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     110300080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  110300080 NCBI-ProteinID:  XP_021025788 Ensembl:  MGP_CAROLIEiJ_G0031393 UniProt:  A0A6P5Q7R1 LinkDB All DBs Position 8:85662015..85662954 Genome browser AA seq 61 aa AA seqDB search MDPNCSCASDGSCSCAGACKCKQCKCTSCKKSCCSCCPVGCAKCSQGCICKEASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgtgcctccgacggatcttgctcctgcgctggcgcctgcaaa tgcaaacaatgcaaatgtacctcctgcaagaaaagctgctgctcctgctgccccgtgggc tgtgcgaagtgctcccagggctgcatctgcaaagaggcttccgacaagtgcagctgctgt gcctga

DBGET integrated database retrieval system