Mus caroli (Ryukyu mouse): 110301647 Help Entry 110301647         CDS       T05910                                  Symbol Ubl5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism mcal  Mus caroli (Ryukyu mouse) Brite KEGG Orthology (KO) [BR:mcal00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:mcal03041]     110301647 (Ubl5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcal04052]     110301647 (Ubl5) Spliceosome [BR:mcal03041]  Complex B   Other components    Complex B specific factors     110301647 (Ubl5) Cytokines and neuropeptides [BR:mcal04052]  Neuropeptides   Unclassified    110301647 (Ubl5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  110301647 NCBI-ProteinID:  XP_021027869 Ensembl:  MGP_CAROLIEiJ_G0031843 UniProt:  A0A6P5QCK8 LinkDB All DBs Position 9:16642293..16645834 Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggtttgcaacgaccgtctcggaaagaaagtccgcgttaagtgcaacacc gatgacaccatcggcgacttgaagaaactgatagctgctcaaactggcacccgctggaac aagatcgttcttaaaaagtggtacacgatatttaaggaccacgtgtctctgggagattat gaaatccacgatgggatgaacctggagctttattaccagtag

DBGET integrated database retrieval system