Mus caroli (Ryukyu mouse): 110302142 Help Entry 110302142         CDS       T05910                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04066   HIF-1 signaling pathway mcal04120   Ubiquitin mediated proteolysis mcal05170   Human immunodeficiency virus 1 infection mcal05200   Pathways in cancer mcal05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:mcal00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     110302142  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     110302142  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110302142   09162 Cancer: specific types    05211 Renal cell carcinoma     110302142   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110302142  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mcal04121]     110302142    03400 DNA repair and recombination proteins [BR:mcal03400]     110302142 Ubiquitin system [BR:mcal04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      110302142    Cul5 complex      110302142 DNA repair and recombination proteins [BR:mcal03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      110302142 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  110302142 NCBI-ProteinID:  XP_021028602 UniProt:  A0A6P5NYR4 LinkDB All DBs Position 1:121826712..121827142 Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGEC GFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPELPDVMKPQDSGGSANEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgtttctcatgatccggcgccacaagaccaccatttttacggacgccaaggag tcgagcaccgtgttcgaactgaagcgcatagtcgagggcatcctcaagcggcctccggag gagcagcggctttacaaggatgaccagctccttgatgatggcaaaactctgggcgagtgt ggcttcactagccagacagcacggccacaggccccagccacagtgggcctggccttccga gcagatgacaccttcgaagctctccgcattgagcccttctccagccctccagaacttcca gatgtgatgaagccacaggattctggaggcagtgccaatgaacaagctgtgcagtga

DBGET integrated database retrieval system