Mus caroli (Ryukyu mouse): 110302282 Help Entry 110302282         CDS       T05910                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04613   Neutrophil extracellular trap formation mcal05034   Alcoholism mcal05202   Transcriptional misregulation in cancer mcal05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcal00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110302282  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     110302282   09163 Immune disease    05322 Systemic lupus erythematosus     110302282   09165 Substance dependence    05034 Alcoholism     110302282  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcal03036]     110302282   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcal04147]     110302282 Chromosome and associated proteins [BR:mcal03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110302282 Exosome [BR:mcal04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110302282 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  110302282 NCBI-ProteinID:  XP_021028818 Ensembl:  MGP_CAROLIEiJ_G0014982 UniProt:  A0A6P5QLJ1 LinkDB All DBs Position 1:complement(170669714..170680461) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatccaccggtggtaaagcacccaggaaacaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaatcagacgctatcagaagtccactgaa cttctgatccgcaagctcccctttcagcgtctggtgcgagaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagataccaatctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagatatccagctagcacgccgcatacgcggagagcgtgcttaa

DBGET integrated database retrieval system