Mus caroli (Ryukyu mouse): 110302438 Help Entry 110302438         CDS       T05910                                  Symbol Rhoa Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04014   Ras signaling pathway mcal04015   Rap1 signaling pathway mcal04022   cGMP-PKG signaling pathway mcal04024   cAMP signaling pathway mcal04062   Chemokine signaling pathway mcal04071   Sphingolipid signaling pathway mcal04072   Phospholipase D signaling pathway mcal04081   Hormone signaling mcal04144   Endocytosis mcal04150   mTOR signaling pathway mcal04270   Vascular smooth muscle contraction mcal04310   Wnt signaling pathway mcal04350   TGF-beta signaling pathway mcal04360   Axon guidance mcal04510   Focal adhesion mcal04520   Adherens junction mcal04530   Tight junction mcal04611   Platelet activation mcal04621   NOD-like receptor signaling pathway mcal04625   C-type lectin receptor signaling pathway mcal04660   T cell receptor signaling pathway mcal04670   Leukocyte transendothelial migration mcal04722   Neurotrophin signaling pathway mcal04810   Regulation of actin cytoskeleton mcal04921   Oxytocin signaling pathway mcal04928   Parathyroid hormone synthesis, secretion and action mcal04972   Pancreatic secretion mcal05100   Bacterial invasion of epithelial cells mcal05132   Salmonella infection mcal05133   Pertussis mcal05135   Yersinia infection mcal05152   Tuberculosis mcal05163   Human cytomegalovirus infection mcal05200   Pathways in cancer mcal05203   Viral carcinogenesis mcal05205   Proteoglycans in cancer mcal05206   MicroRNAs in cancer mcal05210   Colorectal cancer mcal05417   Lipid and atherosclerosis mcal05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mcal00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     110302438 (Rhoa)    04015 Rap1 signaling pathway     110302438 (Rhoa)    04310 Wnt signaling pathway     110302438 (Rhoa)    04350 TGF-beta signaling pathway     110302438 (Rhoa)    04072 Phospholipase D signaling pathway     110302438 (Rhoa)    04071 Sphingolipid signaling pathway     110302438 (Rhoa)    04024 cAMP signaling pathway     110302438 (Rhoa)    04022 cGMP-PKG signaling pathway     110302438 (Rhoa)    04150 mTOR signaling pathway     110302438 (Rhoa)   09133 Signaling molecules and interaction    04081 Hormone signaling     110302438 (Rhoa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110302438 (Rhoa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     110302438 (Rhoa)    04520 Adherens junction     110302438 (Rhoa)    04530 Tight junction     110302438 (Rhoa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     110302438 (Rhoa)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     110302438 (Rhoa)    04621 NOD-like receptor signaling pathway     110302438 (Rhoa)    04625 C-type lectin receptor signaling pathway     110302438 (Rhoa)    04660 T cell receptor signaling pathway     110302438 (Rhoa)    04670 Leukocyte transendothelial migration     110302438 (Rhoa)    04062 Chemokine signaling pathway     110302438 (Rhoa)   09152 Endocrine system    04921 Oxytocin signaling pathway     110302438 (Rhoa)    04928 Parathyroid hormone synthesis, secretion and action     110302438 (Rhoa)   09153 Circulatory system    04270 Vascular smooth muscle contraction     110302438 (Rhoa)   09154 Digestive system    04972 Pancreatic secretion     110302438 (Rhoa)   09156 Nervous system    04722 Neurotrophin signaling pathway     110302438 (Rhoa)   09158 Development and regeneration    04360 Axon guidance     110302438 (Rhoa)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110302438 (Rhoa)    05206 MicroRNAs in cancer     110302438 (Rhoa)    05205 Proteoglycans in cancer     110302438 (Rhoa)    05203 Viral carcinogenesis     110302438 (Rhoa)   09162 Cancer: specific types    05210 Colorectal cancer     110302438 (Rhoa)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     110302438 (Rhoa)   09171 Infectious disease: bacterial    05132 Salmonella infection     110302438 (Rhoa)    05135 Yersinia infection     110302438 (Rhoa)    05133 Pertussis     110302438 (Rhoa)    05152 Tuberculosis     110302438 (Rhoa)    05100 Bacterial invasion of epithelial cells     110302438 (Rhoa)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110302438 (Rhoa)    05418 Fluid shear stress and atherosclerosis     110302438 (Rhoa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcal04131]     110302438 (Rhoa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcal04147]     110302438 (Rhoa)    04031 GTP-binding proteins [BR:mcal04031]     110302438 (Rhoa) Membrane trafficking [BR:mcal04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     110302438 (Rhoa) Exosome [BR:mcal04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110302438 (Rhoa)   Exosomal proteins of other body fluids (saliva and urine)    110302438 (Rhoa)   Exosomal proteins of colorectal cancer cells    110302438 (Rhoa)   Exosomal proteins of bladder cancer cells    110302438 (Rhoa) GTP-binding proteins [BR:mcal04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     110302438 (Rhoa) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  110302438 NCBI-ProteinID:  XP_029337260 UniProt:  A0A6P7RL24 LinkDB All DBs Position 9:103647507..103671510 Genome browser AA seq 94 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLGE NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggctgccatcaggaagaaactggtgattgttggtgatggagcttgtggtaagacatgc ttgctcatagtcttcagcaaggaccagttcccagaggtctatgtgcccacggtgtttgaa aactatgtggcggatatcgaggtggatgggaagcaggtagagttggctttatgggacaca gctggacaggaagattatgaccgcctgaggcctctctcttatccagacactgatgttata ttgatgtgtttttccattgacagccctgatagtttaggtgagtag

DBGET integrated database retrieval system