Mus caroli (Ryukyu mouse): 110303170 Help Entry 110303170         CDS       T05910                                  Symbol Rab5b Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04014   Ras signaling pathway mcal04137   Mitophagy - animal mcal04144   Endocytosis mcal04145   Phagosome mcal04148   Efferocytosis mcal04962   Vasopressin-regulated water reabsorption mcal05132   Salmonella infection mcal05146   Amoebiasis mcal05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mcal00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     110303170 (Rab5b)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110303170 (Rab5b)    04145 Phagosome     110303170 (Rab5b)    04137 Mitophagy - animal     110303170 (Rab5b)    04148 Efferocytosis     110303170 (Rab5b)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     110303170 (Rab5b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110303170 (Rab5b)    05152 Tuberculosis     110303170 (Rab5b)   09174 Infectious disease: parasitic    05146 Amoebiasis     110303170 (Rab5b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcal04131]     110303170 (Rab5b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcal04147]     110303170 (Rab5b)    04031 GTP-binding proteins [BR:mcal04031]     110303170 (Rab5b) Membrane trafficking [BR:mcal04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     110303170 (Rab5b)  Endosome - Lysosome transport     110303170 (Rab5b) Exosome [BR:mcal04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110303170 (Rab5b)   Exosomal proteins of other body fluids (saliva and urine)    110303170 (Rab5b)   Exosomal proteins of colorectal cancer cells    110303170 (Rab5b)   Exosomal proteins of melanoma cells    110303170 (Rab5b) GTP-binding proteins [BR:mcal04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     110303170 (Rab5b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  110303170 NCBI-ProteinID:  XP_021029813 UniProt:  A0A6P5QND5 LinkDB All DBs Position 10:complement(121042875..121060409) Genome browser AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagtacagccaggcccaatgggcaaccacaggccagcaaaatatgccag ttcaaattggtcctgctgggagagtctgcggtggggaagtctagcctggtgttacgtttt gtcaaaggacagttccatgaataccaggaaagcaccattggagcggccttcctcacccaa tccgtgtgtctagatgacacaacagtcaagtttgagatctgggacactgctgggcaggag cgataccacagtttagcccctatgtactacaggggtgcccaggctgcaatcgtggtctat gatattactaatcaggaaacgtttgctcgggcaaagacatgggtaaaggaactacagcgg caagccagccctagcattgttattgccttggcagggaacaaagctgaccttgccaacaag cgcatggtggagtatgaagaggctcaggcatatgcagatgacaacagtttattatttatg gagacttcagctaagactgctatgaacgtgaatgatctcttcctggcaatagcaaagaag ttgccaaagagtgaaccccagaatctggggggtgcggcaggccgaagtcggggtgtggat cttcatgagcagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system