Mus caroli (Ryukyu mouse): 110304839 Help Entry 110304839         CDS       T05910                                  Symbol Ppp3r1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04010   MAPK signaling pathway mcal04020   Calcium signaling pathway mcal04022   cGMP-PKG signaling pathway mcal04114   Oocyte meiosis mcal04218   Cellular senescence mcal04310   Wnt signaling pathway mcal04360   Axon guidance mcal04370   VEGF signaling pathway mcal04380   Osteoclast differentiation mcal04625   C-type lectin receptor signaling pathway mcal04650   Natural killer cell mediated cytotoxicity mcal04658   Th1 and Th2 cell differentiation mcal04659   Th17 cell differentiation mcal04660   T cell receptor signaling pathway mcal04662   B cell receptor signaling pathway mcal04720   Long-term potentiation mcal04724   Glutamatergic synapse mcal04921   Oxytocin signaling pathway mcal04922   Glucagon signaling pathway mcal04924   Renin secretion mcal05010   Alzheimer disease mcal05014   Amyotrophic lateral sclerosis mcal05020   Prion disease mcal05022   Pathways of neurodegeneration - multiple diseases mcal05031   Amphetamine addiction mcal05152   Tuberculosis mcal05163   Human cytomegalovirus infection mcal05166   Human T-cell leukemia virus 1 infection mcal05167   Kaposi sarcoma-associated herpesvirus infection mcal05170   Human immunodeficiency virus 1 infection mcal05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mcal05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcal00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110304839 (Ppp3r1)    04310 Wnt signaling pathway     110304839 (Ppp3r1)    04370 VEGF signaling pathway     110304839 (Ppp3r1)    04020 Calcium signaling pathway     110304839 (Ppp3r1)    04022 cGMP-PKG signaling pathway     110304839 (Ppp3r1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     110304839 (Ppp3r1)    04218 Cellular senescence     110304839 (Ppp3r1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110304839 (Ppp3r1)    04650 Natural killer cell mediated cytotoxicity     110304839 (Ppp3r1)    04660 T cell receptor signaling pathway     110304839 (Ppp3r1)    04658 Th1 and Th2 cell differentiation     110304839 (Ppp3r1)    04659 Th17 cell differentiation     110304839 (Ppp3r1)    04662 B cell receptor signaling pathway     110304839 (Ppp3r1)   09152 Endocrine system    04922 Glucagon signaling pathway     110304839 (Ppp3r1)    04921 Oxytocin signaling pathway     110304839 (Ppp3r1)    04924 Renin secretion     110304839 (Ppp3r1)   09156 Nervous system    04724 Glutamatergic synapse     110304839 (Ppp3r1)    04720 Long-term potentiation     110304839 (Ppp3r1)   09158 Development and regeneration    04360 Axon guidance     110304839 (Ppp3r1)    04380 Osteoclast differentiation     110304839 (Ppp3r1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     110304839 (Ppp3r1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110304839 (Ppp3r1)    05170 Human immunodeficiency virus 1 infection     110304839 (Ppp3r1)    05163 Human cytomegalovirus infection     110304839 (Ppp3r1)    05167 Kaposi sarcoma-associated herpesvirus infection     110304839 (Ppp3r1)   09171 Infectious disease: bacterial    05152 Tuberculosis     110304839 (Ppp3r1)   09164 Neurodegenerative disease    05010 Alzheimer disease     110304839 (Ppp3r1)    05014 Amyotrophic lateral sclerosis     110304839 (Ppp3r1)    05020 Prion disease     110304839 (Ppp3r1)    05022 Pathways of neurodegeneration - multiple diseases     110304839 (Ppp3r1)   09165 Substance dependence    05031 Amphetamine addiction     110304839 (Ppp3r1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110304839 (Ppp3r1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mcal01009]     110304839 (Ppp3r1) Protein phosphatases and associated proteins [BR:mcal01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      110304839 (Ppp3r1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  110304839 NCBI-ProteinID:  XP_021032119 Ensembl:  MGP_CAROLIEiJ_G0016107 UniProt:  A0A6P5QTL4 LinkDB All DBs Position 11:13228887..13270501 Genome browser AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcgagttaccctttggaaatgtgctcacactttgatgctgatgaaatt aaaaggctaggaaagagattcaagaagcttgatttggacaattctggttctttgagcgtg gaagagttcatgtctctgcctgagttacagcagaaccctttggtacagcgggtaatagat atattcgacacagacggcaacggagaagtggacttcaaagaattcattgaaggagtctct cagttcagtgtcaaaggcgataaggaacagaagttgaggtttgcttttcgtatctatgac atggataaagatggctatatttccaatggagaactcttccaggtgttgaagatgatggtg ggcaacaatctgaaagatacacaattacagcagattgtagacaaaaccataataaatgcg gataaggatggagatggaagaatatcctttgaggaattctgtgctgttgtaggtggccta gatatccacaaaaagatggtggtggatgtgtga

DBGET integrated database retrieval system