Mus caroli (Ryukyu mouse): 110306171 Help Entry 110306171         CDS       T05910                                  Symbol Il5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04060   Cytokine-cytokine receptor interaction mcal04630   JAK-STAT signaling pathway mcal04640   Hematopoietic cell lineage mcal04657   IL-17 signaling pathway mcal04658   Th1 and Th2 cell differentiation mcal04660   T cell receptor signaling pathway mcal04664   Fc epsilon RI signaling pathway mcal04672   Intestinal immune network for IgA production mcal05200   Pathways in cancer mcal05310   Asthma mcal05320   Autoimmune thyroid disease mcal05321   Inflammatory bowel disease mcal05330   Allograft rejection Brite KEGG Orthology (KO) [BR:mcal00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110306171 (Il5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110306171 (Il5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     110306171 (Il5)    04660 T cell receptor signaling pathway     110306171 (Il5)    04658 Th1 and Th2 cell differentiation     110306171 (Il5)    04657 IL-17 signaling pathway     110306171 (Il5)    04664 Fc epsilon RI signaling pathway     110306171 (Il5)    04672 Intestinal immune network for IgA production     110306171 (Il5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110306171 (Il5)   09163 Immune disease    05310 Asthma     110306171 (Il5)    05320 Autoimmune thyroid disease     110306171 (Il5)    05321 Inflammatory bowel disease     110306171 (Il5)    05330 Allograft rejection     110306171 (Il5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcal04052]     110306171 (Il5)    00536 Glycosaminoglycan binding proteins [BR:mcal00536]     110306171 (Il5) Cytokines and neuropeptides [BR:mcal04052]  Cytokines   Interleukins    110306171 (Il5) Glycosaminoglycan binding proteins [BR:mcal00536]  Heparan sulfate / Heparin   Cytokines    110306171 (Il5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 GT-D VCD Motif Other DBs NCBI-GeneID:  110306171 NCBI-ProteinID:  XP_021034036 Ensembl:  MGP_CAROLIEiJ_G0016345 UniProt:  A0A6P5QS45 LinkDB All DBs Position 11:48658910..48662976 Genome browser AA seq 133 aa AA seqDB search MRRMLLHLSVLTLSCVWATAMEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQ LCIGDIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQE FLGVMSTEWAMEG NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgaggagaatgcttctgcacttgagcgttctgactctcagctgtgtctgggccactgcc atggagattcccatgagcacagtggtgaaagagaccttgacacagctgtccgctcaccga gctctgttgacaagcaacgagacgatgaggcttcctgtccctactcataaaaatcaccag ctatgcattggagacatctttcaggggctagacatactgaagaatcaaactgtccgcggg ggtactgtggaaatgctattccaaaacttgtcattaataaagaaatacattgaccgccaa aaagagaagtgtggcgaggagagacggaggacgaggcagttcctggattacctgcaagag ttccttggtgtgatgagtacggagtgggcaatggaaggctga

DBGET integrated database retrieval system