Mus caroli (Ryukyu mouse): 110307102 Help Entry 110307102         CDS       T05910                                  Symbol Arf6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04014   Ras signaling pathway mcal04072   Phospholipase D signaling pathway mcal04144   Endocytosis mcal04517   IgSF CAM signaling mcal04666   Fc gamma R-mediated phagosome formation mcal05132   Salmonella infection mcal05135   Yersinia infection Brite KEGG Orthology (KO) [BR:mcal00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     110307102 (Arf6)    04072 Phospholipase D signaling pathway     110307102 (Arf6)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     110307102 (Arf6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110307102 (Arf6)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagosome formation     110307102 (Arf6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110307102 (Arf6)    05135 Yersinia infection     110307102 (Arf6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcal04131]     110307102 (Arf6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcal04147]     110307102 (Arf6)    04031 GTP-binding proteins [BR:mcal04031]     110307102 (Arf6) Membrane trafficking [BR:mcal04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     110307102 (Arf6)   Arf GTPases and associated proteins    Arf GTPases     110307102 (Arf6) Exosome [BR:mcal04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110307102 (Arf6)   Exosomal proteins of colorectal cancer cells    110307102 (Arf6) GTP-binding proteins [BR:mcal04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     110307102 (Arf6) SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  110307102 NCBI-ProteinID:  XP_021035006 Ensembl:  MGP_CAROLIEiJ_G0017806 UniProt:  A0A6P5QWM5 LinkDB All DBs Position 12:64035934..64039824 Genome browser AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaggtgctatccaagatcttcgggaacaaggaaatgcggatcctcatgctgggc ctggacgcagccggcaagacaacgatcctgtacaagttgaagctgggccagtcggtgacc accatccccacggtgggcttcaacgtggagacggtgacttacaaaaacgtcaagttcaac gtgtgggatgtgggcggccaggacaagatccggccgctctggcggcattactacaccggg acccagggtctgatcttcgtggtagactgcgccgatcgcgaccgcatagacgaggcccgc caggagctgcaccgcattatcaatgaccgggagatgagggatgccatcatcctcatcttc gccaacaagcaggacctgcccgatgccatgaaaccccatgagatccaggagaaactgggc ctgacccggattcgggacaggaactggtatgtgcagccctcctgtgccacctccggggac ggactctatgaggggctcacatggttaacctctaactacaaatcctaa

DBGET integrated database retrieval system