Mus caroli (Ryukyu mouse): 110307436 Help Entry 110307436         CDS       T05910                                  Symbol Pfn4 Name (RefSeq) profilin-4   KO K05759   profilin Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04015   Rap1 signaling pathway mcal04810   Regulation of actin cytoskeleton mcal05014   Amyotrophic lateral sclerosis mcal05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mcal00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     110307436 (Pfn4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     110307436 (Pfn4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110307436 (Pfn4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     110307436 (Pfn4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcal04131]     110307436 (Pfn4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mcal04812]     110307436 (Pfn4)    04147 Exosome [BR:mcal04147]     110307436 (Pfn4) Membrane trafficking [BR:mcal04131]  Others   Actin-binding proteins    Others     110307436 (Pfn4) Cytoskeleton proteins [BR:mcal04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      110307436 (Pfn4) Exosome [BR:mcal04147]  Exosomal proteins   Proteins found in most exosomes    110307436 (Pfn4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  110307436 NCBI-ProteinID:  XP_029340751 Ensembl:  MGP_CAROLIEiJ_G0017589 UniProt:  A0A6P7RXC5 LinkDB All DBs Position 12:1570529..1580287 Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQEKTLCVTSPGFSVMPSDVRTLLNGFAKNPLLTR REGLYFKEKDYKCVRADDHSLYAKNENTGVVVVKTNMYLVVATYTAGMYPSVCVEATEKL GEYLRKRGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagtcacttgcagaacttactgttagataccctactggggacgaaacacgtggacagc gcagccctcatcaaactccaggaaaagaccctgtgtgtgacatcaccaggatttagtgta atgccaagtgatgttcgaacacttctgaatggatttgccaaaaacccattattaacccga agggaagggttgtatttcaaggaaaaggattacaaatgtgtccgggccgatgaccattct ctctatgctaagaatgagaacactggtgtggtggtggtgaagaccaacatgtatcttgtg gtggcaacttacactgcaggcatgtatcctagcgtctgcgtggaagccacagagaagctg ggagagtatctaaggaaaaggggaaactaa

DBGET integrated database retrieval system