Mus caroli (Ryukyu mouse): 110308159 Help Entry 110308159         CDS       T05910                                  Name (RefSeq) histone H2B type 1-A   KO K11252   histone H2B Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04613   Neutrophil extracellular trap formation mcal05034   Alcoholism mcal05203   Viral carcinogenesis mcal05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcal00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110308159  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     110308159   09163 Immune disease    05322 Systemic lupus erythematosus     110308159   09165 Substance dependence    05034 Alcoholism     110308159  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcal03036]     110308159   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcal04147]     110308159 Chromosome and associated proteins [BR:mcal03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110308159 Exosome [BR:mcal04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110308159 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa FMN_bind ARM_TT21 Motif Other DBs NCBI-GeneID:  110308159 NCBI-ProteinID:  XP_021036199 Ensembl:  MGP_CAROLIEiJ_G0018345 UniProt:  A0A6P5QX26 LinkDB All DBs Position 13:complement(19762685..19763141) Genome browser AA seq 127 aa AA seqDB search MPEVAVKGATISKKGFKKAVTKTQKKEGRKRKRCRKESYSIYIYKVLKQVHPDTGISSKA MSIMNSFVTDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgccggaggtggcggtaaagggtgctactatttccaagaaaggcttcaagaaagcggtc accaagacccagaaaaaggagggccggaaacgtaagagatgccgcaaggagagctactcc atttacatctataaggtgctgaaacaagtgcaccccgacaccggcatctcctctaaggcc atgagcatcatgaactcctttgtgacagacatcttcgagcgcatcgcgagcgaggcgtcc cgcctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtg cgcctgctgctgcccggggagctggccaagcacgcggtgtccgagggcaccaaggccgtc accaagtacaccagctccaagtga

DBGET integrated database retrieval system