Mus caroli (Ryukyu mouse): 110308577 Help Entry 110308577         CDS       T05910                                  Symbol Calml3 Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04014   Ras signaling pathway mcal04015   Rap1 signaling pathway mcal04020   Calcium signaling pathway mcal04022   cGMP-PKG signaling pathway mcal04024   cAMP signaling pathway mcal04070   Phosphatidylinositol signaling system mcal04114   Oocyte meiosis mcal04218   Cellular senescence mcal04261   Adrenergic signaling in cardiomyocytes mcal04270   Vascular smooth muscle contraction mcal04371   Apelin signaling pathway mcal04625   C-type lectin receptor signaling pathway mcal04713   Circadian entrainment mcal04720   Long-term potentiation mcal04722   Neurotrophin signaling pathway mcal04728   Dopaminergic synapse mcal04740   Olfactory transduction mcal04744   Phototransduction mcal04750   Inflammatory mediator regulation of TRP channels mcal04910   Insulin signaling pathway mcal04912   GnRH signaling pathway mcal04915   Estrogen signaling pathway mcal04916   Melanogenesis mcal04921   Oxytocin signaling pathway mcal04922   Glucagon signaling pathway mcal04924   Renin secretion mcal04925   Aldosterone synthesis and secretion mcal04970   Salivary secretion mcal04971   Gastric acid secretion mcal05010   Alzheimer disease mcal05012   Parkinson disease mcal05022   Pathways of neurodegeneration - multiple diseases mcal05031   Amphetamine addiction mcal05034   Alcoholism mcal05133   Pertussis mcal05152   Tuberculosis mcal05163   Human cytomegalovirus infection mcal05167   Kaposi sarcoma-associated herpesvirus infection mcal05170   Human immunodeficiency virus 1 infection mcal05200   Pathways in cancer mcal05214   Glioma mcal05417   Lipid and atherosclerosis mcal05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mcal00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     110308577 (Calml3)    04015 Rap1 signaling pathway     110308577 (Calml3)    04371 Apelin signaling pathway     110308577 (Calml3)    04020 Calcium signaling pathway     110308577 (Calml3)    04070 Phosphatidylinositol signaling system     110308577 (Calml3)    04024 cAMP signaling pathway     110308577 (Calml3)    04022 cGMP-PKG signaling pathway     110308577 (Calml3)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     110308577 (Calml3)    04218 Cellular senescence     110308577 (Calml3)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110308577 (Calml3)   09152 Endocrine system    04910 Insulin signaling pathway     110308577 (Calml3)    04922 Glucagon signaling pathway     110308577 (Calml3)    04912 GnRH signaling pathway     110308577 (Calml3)    04915 Estrogen signaling pathway     110308577 (Calml3)    04921 Oxytocin signaling pathway     110308577 (Calml3)    04916 Melanogenesis     110308577 (Calml3)    04924 Renin secretion     110308577 (Calml3)    04925 Aldosterone synthesis and secretion     110308577 (Calml3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     110308577 (Calml3)    04270 Vascular smooth muscle contraction     110308577 (Calml3)   09154 Digestive system    04970 Salivary secretion     110308577 (Calml3)    04971 Gastric acid secretion     110308577 (Calml3)   09156 Nervous system    04728 Dopaminergic synapse     110308577 (Calml3)    04720 Long-term potentiation     110308577 (Calml3)    04722 Neurotrophin signaling pathway     110308577 (Calml3)   09157 Sensory system    04744 Phototransduction     110308577 (Calml3)    04740 Olfactory transduction     110308577 (Calml3)    04750 Inflammatory mediator regulation of TRP channels     110308577 (Calml3)   09159 Environmental adaptation    04713 Circadian entrainment     110308577 (Calml3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110308577 (Calml3)   09162 Cancer: specific types    05214 Glioma     110308577 (Calml3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110308577 (Calml3)    05163 Human cytomegalovirus infection     110308577 (Calml3)    05167 Kaposi sarcoma-associated herpesvirus infection     110308577 (Calml3)   09171 Infectious disease: bacterial    05133 Pertussis     110308577 (Calml3)    05152 Tuberculosis     110308577 (Calml3)   09164 Neurodegenerative disease    05010 Alzheimer disease     110308577 (Calml3)    05012 Parkinson disease     110308577 (Calml3)    05022 Pathways of neurodegeneration - multiple diseases     110308577 (Calml3)   09165 Substance dependence    05031 Amphetamine addiction     110308577 (Calml3)    05034 Alcoholism     110308577 (Calml3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110308577 (Calml3)    05418 Fluid shear stress and atherosclerosis     110308577 (Calml3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mcal01009]     110308577 (Calml3)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcal04131]     110308577 (Calml3)    03036 Chromosome and associated proteins [BR:mcal03036]     110308577 (Calml3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcal04147]     110308577 (Calml3) Protein phosphatases and associated proteins [BR:mcal01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      110308577 (Calml3) Membrane trafficking [BR:mcal04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     110308577 (Calml3) Chromosome and associated proteins [BR:mcal03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      110308577 (Calml3) Exosome [BR:mcal04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    110308577 (Calml3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C UPF0154 EFhand_Ca_insen Dockerin_1 EF-hand_11 DUF5580_M RNA_pol_Rpb4 FCaBP_EF-hand Caleosin dCache_2 DUF1103 SPEF2_C SurA_N_2 SurA_N_3 DUF6279 RFC1 Motif Other DBs NCBI-GeneID:  110308577 NCBI-ProteinID:  XP_021036670 Ensembl:  MGP_CAROLIEiJ_G0018194 UniProt:  A0A6P5QXW7 LinkDB All DBs Position 13:complement(327367..328772) Genome browser AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGSITTQELGTVMRSLGQNPTEAELQGMVNEIDKDG NGTVDFPEFLTMMSRKMKDTDSEEEIREAFRVFDKDGNGFVSAAELRHVMTKLGEKLSDE EVDEMIQAADTDGDGQVNYEEFVHMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagcttactgaggagcaaatcgccgaattcaaagaggctttctctctgttt gacaaggatggggatggcagtatcaccacccaagaactgggcactgtcatgcggtccctg ggtcagaaccccacagaggctgagcttcaaggcatggtgaatgaaattgacaaggatgga aacggcaccgtggacttccccgagttcctgacaatgatgtccaggaagatgaaagacact gacagcgaggaggagatccgggaggccttccgagtgttcgacaaggatggcaatggcttc gtcagtgcagccgagctgaggcacgtgatgaccaagctgggggagaagctgagcgatgag gaggtggacgaaatgatacaggcggcagatacagatggtgatgggcaagtgaactatgag gagtttgtccacatgctagtgtccaaatga

DBGET integrated database retrieval system