Mus caroli (Ryukyu mouse): 110308657 Help Entry 110308657         CDS       T05910                                  Name (RefSeq) histone H2B type 1   KO K11252   histone H2B Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04613   Neutrophil extracellular trap formation mcal05034   Alcoholism mcal05203   Viral carcinogenesis mcal05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcal00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110308657  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     110308657   09163 Immune disease    05322 Systemic lupus erythematosus     110308657   09165 Substance dependence    05034 Alcoholism     110308657  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcal03036]     110308657   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcal04147]     110308657 Chromosome and associated proteins [BR:mcal03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110308657 Exosome [BR:mcal04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110308657 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  110308657 NCBI-ProteinID:  XP_021036738 Ensembl:  MGP_CAROLIEiJ_G0018284 UniProt:  A0A6P7PVI0 LinkDB All DBs Position 13:complement(16893732..16894183) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagcctgcgaagtccgctcccgccccgaagaagggctccaagaaggccgtgacc aaggcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagttactcggtg tacgtgtacaaggtgctgaagcaagtgcaccccgacaccggcatctcctccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcaggcgaggcgtcccgc ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgcggtgtcggagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system