Mus caroli (Ryukyu mouse): 110309379 Help Entry 110309379         CDS       T05910                                  Symbol Spint3 Name (RefSeq) kunitz-type protease inhibitor 3   KO K23422   Kunitz-type protease inhibitor 3 Organism mcal  Mus caroli (Ryukyu mouse) Brite KEGG Orthology (KO) [BR:mcal00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:mcal01002]     110309379 (Spint3) Peptidases and inhibitors [BR:mcal01002]  Peptidase inhibitors   Family I2: Kunitz - BPTI family    110309379 (Spint3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Kunitz_BPTI Motif Other DBs NCBI-GeneID:  110309379 NCBI-ProteinID:  XP_021037661 Ensembl:  MGP_CAROLIEiJ_G0024651 UniProt:  A0A6P5R000 LinkDB All DBs Position 2:complement(156506663..156510184) Genome browser AA seq 88 aa AA seqDB search MQLQASFFLFLILIFCPELCAEPNNVPRKSLPPMCILPKDTGGCRAVFVRWYYNSKAGKC EWFRYGGCKGNENNFPSRSQCQAVCTNT NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgcaactccaggcctccttcttcttattcctgatcctcatcttctgcccagagctttgc gcagaaccaaataacgtgcccaggaagtccttaccgcctatgtgcatccttcctaaggac acgggcggatgccgagctgtgtttgtgagatggtactataactccaaagctggcaagtgt gagtggttccgctatggaggctgcaaaggcaacgagaacaacttcccgagcagaagtcag tgccaggcagtctgcaccaacacctga

DBGET integrated database retrieval system