Mus caroli (Ryukyu mouse): 110310350 Help Entry 110310350         CDS       T05910                                  Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal03410   Base excision repair mcal04140   Autophagy - animal mcal04217   Necroptosis mcal04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:mcal00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     110310350  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110310350   09143 Cell growth and death    04217 Necroptosis     110310350  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110310350  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcal03036]     110310350    03400 DNA repair and recombination proteins [BR:mcal03400]     110310350   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcal04147]     110310350 Chromosome and associated proteins [BR:mcal03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     110310350 DNA repair and recombination proteins [BR:mcal03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      110310350    MMR (mismatch excision repair)     Other MMR factors      110310350 Exosome [BR:mcal04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    110310350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 HMG_box_5 Nop14 NOA36 Motif Other DBs NCBI-GeneID:  110310350 NCBI-ProteinID:  XP_021038885 UniProt:  A0A6P5QWC4 LinkDB All DBs Position 15:31094113..31095368 Genome browser AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHLDASVNFSEFSKKCSERWKTMSAKEKGKF EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDIAKKLGEMWNNTAADDKQPYEKKAAXLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKKEEDDEEDEEDEEEEEEEEDEDEEEEDADE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggagatcctaagaagccgagaggcaaaatgtcctcatatgcattctttgtg caaacttgccgggaggagcacaagaagaagcacctggatgcttctgtcaacttctcagag ttctccaagaagtgctcagagaggtggaagaccatgtctgctaaagaaaaggggaaattt gaagatatggcaaaggctgacaaggctcgttatgaaagagaaatgaaaacctacatcccc cccaaaggggagaccaaaaagaagttcaaggaccccaatgcacccaagaggcctccttcg gccttcttcttgttctgttctgagtaccgccccaaaatcaaaggcgagcatcctggctta tccattggtgatattgcaaagaaactaggagagatgtggaacaacactgcagcagatgac aagcagccctatgagaagaaagctgccaanctgaaggagaagtacgagaaggatattgct gcctacagagctaaaggaaaacctgatgcagcaaaaaagggggtggtcaaggctgaaaag agcaagaaaaagaagaaagaggaagatgatgaggaggatgaagaagatgaggaagaggaa gaagaagaggaggatgaagatgaggaagaagaagatgctgatgaataa

DBGET integrated database retrieval system