KEGG   Mus caroli (Ryukyu mouse): 110311994
Entry
110311994         CDS       T05910                                 
Symbol
Mrap
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04927  Cortisol synthesis and secretion
mcal04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    110311994 (Mrap)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110311994 (Mrap)
SSDB
Motif
Pfam: MRAP
Other DBs
NCBI-GeneID: 110311994
NCBI-ProteinID: XP_021041223
Ensembl: MGP_CAROLIEiJ_G0020947
UniProt: A0A6P5R1V3
LinkDB
Position
16:85125430..85137313
AA seq 127 aa
MANRTDASVPLTSYEYYLDYIDLIPVDEKKLKANKHSIIIALWLSLATFVVLLFLILLYM
SWSGSPQMRHSPQPQPICPWTHSFNLPLCLRRASLQTTEEPGRRAGTDQWLTQQSPSASA
LGPLALP
NT seq 384 nt   +upstreamnt  +downstreamnt
atggccaacaggaccgacgcctctgtcccgctcaccagctatgagtattacctggactac
atagacctcattcctgtggacgagaagaagctgaaagccaacaagcattccatcatcatt
gccctgtggctgagcctggctaccttcgtggtgctcctcttcctcatcctgctctacatg
tcctggtcgggctccccgcagatgaggcacagtccccaaccccagccaatatgtccgtgg
actcacagtttcaacctccccctgtgcctccggagggcctccctgcagactacagaggag
ccaggaaggagagctggcactgaccagtggttaacgcagcagagtccttctgcctcagcc
ctggggcccctggctctcccctag

DBGET integrated database retrieval system