Mus caroli (Ryukyu mouse): 110312675 Help Entry 110312675         CDS       T05910                                  Symbol Rab5a Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04014   Ras signaling pathway mcal04137   Mitophagy - animal mcal04144   Endocytosis mcal04145   Phagosome mcal04148   Efferocytosis mcal04962   Vasopressin-regulated water reabsorption mcal05014   Amyotrophic lateral sclerosis mcal05022   Pathways of neurodegeneration - multiple diseases mcal05132   Salmonella infection mcal05146   Amoebiasis mcal05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mcal00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     110312675 (Rab5a)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110312675 (Rab5a)    04145 Phagosome     110312675 (Rab5a)    04137 Mitophagy - animal     110312675 (Rab5a)    04148 Efferocytosis     110312675 (Rab5a)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     110312675 (Rab5a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110312675 (Rab5a)    05152 Tuberculosis     110312675 (Rab5a)   09174 Infectious disease: parasitic    05146 Amoebiasis     110312675 (Rab5a)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     110312675 (Rab5a)    05022 Pathways of neurodegeneration - multiple diseases     110312675 (Rab5a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcal04131]     110312675 (Rab5a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcal04147]     110312675 (Rab5a)    04031 GTP-binding proteins [BR:mcal04031]     110312675 (Rab5a) Membrane trafficking [BR:mcal04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     110312675 (Rab5a)  Endosome - Lysosome transport     110312675 (Rab5a) Exosome [BR:mcal04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110312675 (Rab5a)   Exosomal proteins of other body fluids (saliva and urine)    110312675 (Rab5a)   Exosomal proteins of colorectal cancer cells    110312675 (Rab5a)   Exosomal proteins of bladder cancer cells    110312675 (Rab5a) GTP-binding proteins [BR:mcal04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     110312675 (Rab5a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  110312675 NCBI-ProteinID:  XP_021042135 Ensembl:  MGP_CAROLIEiJ_G0021741 UniProt:  A0A6P7QCG9 LinkDB All DBs Position 17:50091136..50118147 Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPAQPARSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactggtccttctaggagagtctgctgttggcaaatcaagcctggttcttcgcttt gtgaaaggccaatttcatgaatttcaagagagtaccattggggctgcctttctaacccaa actgtgtgtcttgatgacacaacagtaaaatttgaaatatgggatacagctggtcaagaa cggtatcacagcctagcaccaatgtactaccgaggagcacaagcagccatagttgtgtat gatatcacaaatgaggaatcctttgcgagagcaaaaaactgggttaaagaacttcagagg caagcgagtcctaatattgtgatagctttgtcaggaaacaaagccgacttagcaaataaa agagccgttgacttccaggaagcacagtcctatgcagatgacaacagcttattatttatg gagacatcagctaagacatcaatgaatgtaaatgaaatatttatggcaatagctaaaaag ctgccaaagaatgaaccacagaatccaggcgcaaactcagccagaggacgaggagtagac cttactgagcctgcacagccagccagaagccagtgttgtagtaactga

DBGET integrated database retrieval system