Mus caroli (Ryukyu mouse): 115029089 Help Entry 115029089         CDS       T05910                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal04613   Neutrophil extracellular trap formation mcal05034   Alcoholism mcal05202   Transcriptional misregulation in cancer mcal05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mcal00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     115029089  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     115029089   09163 Immune disease    05322 Systemic lupus erythematosus     115029089   09165 Substance dependence    05034 Alcoholism     115029089  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcal03036]     115029089   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcal04147]     115029089 Chromosome and associated proteins [BR:mcal03036]  Eukaryotic type   Nucleosome assembly factors    Histones     115029089 Exosome [BR:mcal04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115029089 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  115029089 NCBI-ProteinID:  XP_029324256 Ensembl:  MGP_CAROLIEiJ_G0018332 UniProt:  A0A6P5QY22 LinkDB All DBs Position 13:complement(19572640..19573253) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtactaagcagaccgctcgcaagtccaccggcggcaaggccccgcgcaagcag ctggccaccaaggccgcccgcaagagcgccccggccaccggcggcgtgaagaagcctcac cgctaccgccccggcaccgtggcgctgcgcgagatccggcgctaccagaagtcgaccgag ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggctctgcaggaggcgagcgaggcctac cttgtgggtctgtttgaggacaccaacctgtgcgccatccacgccaagcgtgtcaccatc atgcccaaggacatccagctggcccgccgcatccgtggcgagagagcgtaa

DBGET integrated database retrieval system