Macaca mulatta (rhesus monkey): 100689487 Help Entry 100689487         CDS       T01028                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc00510   N-Glycan biosynthesis mcc00513   Various types of N-glycan biosynthesis mcc04141   Protein processing in endoplasmic reticulum Module mcc_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:mcc00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     100689487 (TMEM258)    00513 Various types of N-glycan biosynthesis     100689487 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100689487 (TMEM258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  100689487 NCBI-ProteinID:  NP_001231531 Ensembl:  ENSMMUG00000006656 UniProt:  F7H3Z8 LinkDB All DBs Position 16:50298013..50298393 Genome browser AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagcttgaggccatgagcagatacaccagcccagtgaacccggctgtcttcccccat ctgaccgtggtgcttttggccatcggcatgttcttcaccgcctggttcttcgtttacgag gtcacctctaccaagtacactcgtgatatctataaagagctcctcatctctttggtggcc tcactcttcatgggctttggagtccttttcctgctgctctgggttggcatctacgtgtga

DBGET integrated database retrieval system