Macaca mulatta (rhesus monkey): 574281 Help Entry 574281            CDS       T01028                                  Symbol IL4 Name (RefSeq) interleukin-4 precursor   KO K05430   interleukin 4 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04060   Cytokine-cytokine receptor interaction mcc04151   PI3K-Akt signaling pathway mcc04630   JAK-STAT signaling pathway mcc04640   Hematopoietic cell lineage mcc04657   IL-17 signaling pathway mcc04658   Th1 and Th2 cell differentiation mcc04659   Th17 cell differentiation mcc04660   T cell receptor signaling pathway mcc04664   Fc epsilon RI signaling pathway mcc04672   Intestinal immune network for IgA production mcc05140   Leishmaniasis mcc05200   Pathways in cancer mcc05310   Asthma mcc05320   Autoimmune thyroid disease mcc05321   Inflammatory bowel disease mcc05330   Allograft rejection Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     574281 (IL4)    04151 PI3K-Akt signaling pathway     574281 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     574281 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     574281 (IL4)    04660 T cell receptor signaling pathway     574281 (IL4)    04658 Th1 and Th2 cell differentiation     574281 (IL4)    04659 Th17 cell differentiation     574281 (IL4)    04657 IL-17 signaling pathway     574281 (IL4)    04664 Fc epsilon RI signaling pathway     574281 (IL4)    04672 Intestinal immune network for IgA production     574281 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     574281 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     574281 (IL4)   09163 Immune disease    05310 Asthma     574281 (IL4)    05320 Autoimmune thyroid disease     574281 (IL4)    05321 Inflammatory bowel disease     574281 (IL4)    05330 Allograft rejection     574281 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     574281 (IL4)    00536 Glycosaminoglycan binding proteins [BR:mcc00536]     574281 (IL4) Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Interleukins    574281 (IL4) Glycosaminoglycan binding proteins [BR:mcc00536]  Heparan sulfate / Heparin   Cytokines    574281 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 Mannosyl_trans3 DUF1907 Motif Other DBs NCBI-GeneID:  574281 NCBI-ProteinID:  NP_001028076 Ensembl:  ENSMMUG00000003133 UniProt:  Q6U8C1 A0A8J8XF11 LinkDB All DBs Position 6:130115269..130123589 Genome browser AA seq 153 aa AA seqDB search MGLTSQLLPPLFFLLACAGNFAHGHNCHIALREIIETLNSLTEQKTLCTKLTITDILAAS KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGL NSCPVKEASQSTLEDFLERLKTIMKEKYSKCRS NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgccggcaac tttgcccacggacacaactgccatatcgccttacgggagatcatcgaaactctgaacagc ctcacagagcagaagactctgtgcaccaagttgaccataacggacatccttgctgcctcc aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac agccaccatgagaaggacactcgctgcctgggtgcgactgcacagcagtttcacaggcac aagcagctgatccgattcctgaaacggctcgacaggaacctctggggcctggcgggcttg aactcctgtcctgtgaaggaagccagccagagtacgttggaagacttcttggaaaggcta aagacgatcatgaaagagaaatattcaaagtgtcggagctga

DBGET integrated database retrieval system