Macaca mulatta (rhesus monkey): 574282 Help Entry 574282            CDS       T01028                                  Symbol IFNG Name (RefSeq) interferon gamma precursor   KO K04687   interferon gamma Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc03050   Proteasome mcc04060   Cytokine-cytokine receptor interaction mcc04066   HIF-1 signaling pathway mcc04217   Necroptosis mcc04350   TGF-beta signaling pathway mcc04380   Osteoclast differentiation mcc04612   Antigen processing and presentation mcc04630   JAK-STAT signaling pathway mcc04650   Natural killer cell mediated cytotoxicity mcc04657   IL-17 signaling pathway mcc04658   Th1 and Th2 cell differentiation mcc04659   Th17 cell differentiation mcc04660   T cell receptor signaling pathway mcc04940   Type I diabetes mellitus mcc05140   Leishmaniasis mcc05142   Chagas disease mcc05143   African trypanosomiasis mcc05144   Malaria mcc05145   Toxoplasmosis mcc05146   Amoebiasis mcc05152   Tuberculosis mcc05160   Hepatitis C mcc05164   Influenza A mcc05168   Herpes simplex virus 1 infection mcc05200   Pathways in cancer mcc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mcc05321   Inflammatory bowel disease mcc05322   Systemic lupus erythematosus mcc05323   Rheumatoid arthritis mcc05330   Allograft rejection mcc05332   Graft-versus-host disease mcc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     574282 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     574282 (IFNG)    04630 JAK-STAT signaling pathway     574282 (IFNG)    04066 HIF-1 signaling pathway     574282 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     574282 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     574282 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     574282 (IFNG)    04612 Antigen processing and presentation     574282 (IFNG)    04660 T cell receptor signaling pathway     574282 (IFNG)    04658 Th1 and Th2 cell differentiation     574282 (IFNG)    04659 Th17 cell differentiation     574282 (IFNG)    04657 IL-17 signaling pathway     574282 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     574282 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     574282 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     574282 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     574282 (IFNG)    05164 Influenza A     574282 (IFNG)    05168 Herpes simplex virus 1 infection     574282 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     574282 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     574282 (IFNG)    05144 Malaria     574282 (IFNG)    05145 Toxoplasmosis     574282 (IFNG)    05140 Leishmaniasis     574282 (IFNG)    05142 Chagas disease     574282 (IFNG)    05143 African trypanosomiasis     574282 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     574282 (IFNG)    05323 Rheumatoid arthritis     574282 (IFNG)    05321 Inflammatory bowel disease     574282 (IFNG)    05330 Allograft rejection     574282 (IFNG)    05332 Graft-versus-host disease     574282 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     574282 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     574282 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:mcc03051]     574282 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     574282 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:mcc00536]     574282 (IFNG) Proteasome [BR:mcc03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     574282 (IFNG) Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Interferons    574282 (IFNG) Glycosaminoglycan binding proteins [BR:mcc00536]  Heparan sulfate / Heparin   Cytokines    574282 (IFNG) SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma NolX Motif Other DBs NCBI-GeneID:  574282 NCBI-ProteinID:  NP_001028077 Ensembl:  ENSMMUG00000019225 UniProt:  P63310 LinkDB All DBs Position 11:complement(67686366..67690606) Genome browser AA seq 165 aa AA seqDB search MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWK EESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTN YSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atgaaatacacaagttatatcttggcttttcagctctgcattgttttgggttctcttggc tgttactgccaggacccatatgtaaaagaagcagaaaaccttaagaaatattttaatgca ggtgatccagatgtagcagataatggaactcttttcttagacatcttgaggaattggaaa gaggagagtgacagaaaaataatgcagagccaaattgtctccttttacttcaaacttttt aaaaacttcaaagatgaccagaggatccaaaagagtgtggagaccatcaaggaagacatt aatgtcaagtttttcaatagcaacaaaaagaaacgggatgactttgaaaagctgaccaat tattcggtaactgactcgaatgtccaacgcaaagcagtacatgaactcatccaagtgatg gctgaactgtcgccagcagctaaaatagggaagcgaaaaaggagtcagatgtttcgaggt cgaagagcatcccaataa

DBGET integrated database retrieval system