Macaca mulatta (rhesus monkey): 574373 Help Entry 574373            CDS       T01028                                  Symbol CD209L2 Name (RefSeq) CD209 antigen-like protein 2   KO K06563   C-type lectin domain family 4 member L/M Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc03260   Virion - Human immunodeficiency virus mcc03264   Virion - Flavivirus and Alphavirus mcc03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus mcc03273   Virion - Lassa virus and SFTS virus mcc04145   Phagocytosis mcc04517   IgSF CAM signaling mcc04625   C-type lectin receptor signaling pathway mcc05152   Tuberculosis mcc05162   Measles Brite KEGG Orthology (KO) [BR:mcc00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     574373 (CD209L2)    03264 Virion - Flavivirus and Alphavirus     574373 (CD209L2)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     574373 (CD209L2)    03273 Virion - Lassa virus and SFTS virus     574373 (CD209L2)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     574373 (CD209L2)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     574373 (CD209L2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     574373 (CD209L2)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     574373 (CD209L2)   09171 Infectious disease: bacterial    05152 Tuberculosis     574373 (CD209L2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcc04131]     574373 (CD209L2)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:mcc04054]     574373 (CD209L2)    04515 Cell adhesion molecules [BR:mcc04515]     574373 (CD209L2)    04090 CD molecules [BR:mcc04090]     574373 (CD209L2)    04091 Lectins [BR:mcc04091]     574373 (CD209L2) Membrane trafficking [BR:mcc04131]  Endocytosis   Phagocytosis    C-lectin receptors     574373 (CD209L2) Pattern recognition receptors [BR:mcc04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    574373 (CD209L2) Cell adhesion molecules [BR:mcc04515]  Lectins   Selectins and C-type lectins    574373 (CD209L2) CD molecules [BR:mcc04090]  Proteins   574373 (CD209L2) Lectins [BR:mcc04091]  C-Type lectins   Asialoglycoprotein and DC receptors    574373 (CD209L2) SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  574373 NCBI-ProteinID:  NP_001028123 Ensembl:  ENSMMUG00000048292 UniProt:  Q8MIS5 LinkDB All DBs Position 19:complement(7675024..7681810) Genome browser AA seq 256 aa AA seqDB search MSDSKEPRAQPLGLLEEEELITSSMNFFPRDFGFRQTRGYKSLAGCLGHAPLVLPLLFFT LFTGLLVAILVQVSKNPSSQRLDQSKQDEISQDLSQLKAAVERLCRPCPWEWTFFQGNCY FISNSQRNWHDSITACQEVGAQLVVIKSAEEQNFLQLQSSRSNRFAWMGLSDLNQEDMWQ WVDDSPLSTSFKQYWNRGEPNNIGEEDCVEFNGNGWNDDKCSAAKFWICKKSAASCSRDE GQLLSSASASPIAHAA NT seq 771 nt NT seq  +upstreamnt  +downstreamnt atgagtgactccaaggaaccaagggcgcagccgctgggcctcctggaagaggaagagctg ataactagcagtatgaatttttttccaagagactttggattccgacagactcgaggctac aagagcttagcagggtgtctgggccacgcacccctggtgctgccgctcctcttcttcaca ctcttcactgggctgctggtggccatccttgtccaagtctccaagaaccccagctcccag aggctggatcagtccaagcaggacgagatctcccaggacctgtcccagctgaaggctgct gtggaacgcctgtgccgcccctgtccctgggagtggacattcttccaaggaaactgttac ttcatatcgaactcccagcggaactggcatgactccatcaccgcctgccaggaggtgggg gcccagctcgtcgtaatcaaaagtgctgaggagcagaacttcctacagctgcagtcttcc agaagtaaccgcttcgcctggatgggactttcagatctaaatcaggaagacatgtggcaa tgggtggacgactcacctctgtcaaccagcttcaagcaatattggaacagaggagagccc aacaatatcggggaggaagactgtgtggaatttaatggcaatggctggaatgacgacaaa tgcagtgctgccaaattctggatctgcaaaaagtctgcagcctcctgctccagagatgaa gggcagcttctctcctcagcctctgcatccccgattgcccatgcggcatag

DBGET integrated database retrieval system